Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_067075672.1 MCUHO_RS06890 glucose 1-dehydrogenase
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_001602375.1:WP_067075672.1 Length = 249 Score = 155 bits (391), Expect = 1e-42 Identities = 103/254 (40%), Positives = 139/254 (54%), Gaps = 14/254 (5%) Query: 3 LKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGR 62 +++K+ ++TG + GIG A A AAEG V ++ G N+ R +V EI+ G Sbjct: 4 MENKICVITGSTSGIGEACAKDMAAEGGKVVVS--GRNEKEGAR------IVNEIKEAGG 55 Query: 63 RVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNL 122 VI I +V + + LV TVEAFG++DV +N+G+ ++ + + + VNL Sbjct: 56 EVIFIRADVTVEDDVRNLVAKTVEAFGRLDVFVANSGVGSLGDPHEVETDEWDRVLDVNL 115 Query: 123 NGAFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALG 182 G F + A QQM QG GGAIV T SI + V T Y K GV L ++ + Sbjct: 116 KGIFLCDKYAVQQMLKQGQGGAIVNTGSIHSFVAKQGVTAYGAAKGGVAMLTRTLGTSYA 175 Query: 183 PYGIRCNSVMPGTIATDLNAQDLADEAKKAYFE--KRIPLGRLGRPEDVADCVTFLASDR 240 GIR N V PG I T L LA ++AY E K P+GRLGRP +VA VTFLASD Sbjct: 176 AQGIRANFVAPGYIDTPL----LAALPREAYEELKKLHPIGRLGRPMEVAKAVTFLASDD 231 Query: 241 ARYVTGAALLVDGG 254 A +TG +LLVDGG Sbjct: 232 ASNITGTSLLVDGG 245 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 249 Length adjustment: 24 Effective length of query: 236 Effective length of database: 225 Effective search space: 53100 Effective search space used: 53100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory