Align TRAP transporter, subunit DctQ (characterized, see rationale)
to candidate WP_068004173.1 PsAD2_RS05440 TRAP transporter small permease
Query= uniprot:I7EY26 (225 letters) >NCBI__GCF_001623255.1:WP_068004173.1 Length = 210 Score = 107 bits (268), Expect = 1e-28 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 23/213 (10%) Query: 11 LINTLEETLIALLLGLMTLITFANVVARFVFNSNILWALELTVFLFAWLVLLGASYAVKV 70 +I+ EE IA +L +MTL+TF VV R+ FNS AL+ T LFAWL+L G SY +K+ Sbjct: 7 IIDAFEEGFIATILAVMTLVTFWQVVMRYGFNSGWGGALQFTRVLFAWLILFGMSYGLKI 66 Query: 71 HAHLGVDAILNMVSPGARRVIGLISVGCCLVFSLLLLKGAYDYWAVFADLPPTSGRWFPT 130 +HLGVDA + + R GLI L+++ LL + W + D +SG Sbjct: 67 GSHLGVDAFIRLFPKPVFRTFGLIGALVTLLYAALLFDADWFGWVLGLDNRGSSG----G 122 Query: 131 GFDMKARSQSFYEVQDVPMVAIFGFLEDLINYGDSY-------EKLPKVVPYVVLPLSML 183 FD +R +Y+ +P+ +EDL + + Y E++P+ YV+LP+ + Sbjct: 123 AFDYVSR---YYK---LPI-----GMEDL-KFPEWYQEMFGVKERVPRWWGYVILPIGLG 170 Query: 184 LMLLRFAQAAMQILRGDVDRLVASHEVEDEIAE 216 L+ R Q IL G D ++A+HE E+ + E Sbjct: 171 LLAFRSLQMCWLILTGQRDTMIAAHEAEELVEE 203 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 210 Length adjustment: 22 Effective length of query: 203 Effective length of database: 188 Effective search space: 38164 Effective search space used: 38164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory