Align Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 (characterized)
to candidate WP_068008417.1 PsAD2_RS16680 threonine ammonia-lyase
Query= SwissProt::Q7XSN8 (339 letters) >NCBI__GCF_001623255.1:WP_068008417.1 Length = 413 Score = 205 bits (521), Expect = 2e-57 Identities = 116/309 (37%), Positives = 181/309 (58%), Gaps = 8/309 (2%) Query: 21 IHSIREAQARIAPYVHKTPVLSSTSIDAIVGKQLFFKCECFQKAGAFKIRGASNSIFALD 80 + +I EA I V KTP L + +DA G +F K E Q AFK RGA N + L Sbjct: 11 LSNIEEAANNIKGAVLKTPFLPAIQLDAATGASVFVKYENMQVTNAFKERGALNKLLHLS 70 Query: 81 DDEASKGVVTHSSGNHAAAVALAAKLRGIPAYIVIPRNAPACKVDNVKRYGGHIIWSDVS 140 D E S+GV+ S+GNHA AVAL A+ GIPA IV+P P KV+ K +G +I + + Sbjct: 71 DTEKSRGVIAMSAGNHAQAVALHAQRLGIPALIVMPNGTPYVKVEATKAFGAKVILAGET 130 Query: 141 IESRESVAKRVQEETGAILVHPFNNKNTISGQGTVSLELLEEVPEIDTIIVPISGGGLIS 200 ++ ++ A R+ +E VHPF++ I+GQGT++LE+L E P++DT++VP+ GGG+IS Sbjct: 131 VDDAKNEADRLAQEHNYTWVHPFDDLEVIAGQGTIALEMLREQPDLDTLVVPVGGGGMIS 190 Query: 201 GVALAAKAINPSIRILAAEPKGADDSAQSKAAGKIITLPSTNTIADGLRAFL-GDLTWPV 259 G+A+AAKAI P I I+ E S + G+ + N++A+G+ + G LT + Sbjct: 191 GMAVAAKAIKPDIEIIGVE-SDLYPSMYAALRGRSMEC-GGNSLAEGIAVKVPGTLTQQL 248 Query: 260 VRDLVDDIIVVDDNAIVDAMKMCYEMLKVAVEPSGAIGLAAALSDEFKQSSAWHESSKIG 319 + V+D+++V ++ I +A+ + LK E +GA GLAA + + K+G Sbjct: 249 CKQFVNDVLLVSESQIEEAINVFLTRLKTVAEGAGAAGLAAICAHPER-----FAGKKVG 303 Query: 320 IIVSGGNVD 328 +++ GGN++ Sbjct: 304 LVLCGGNIN 312 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 413 Length adjustment: 30 Effective length of query: 309 Effective length of database: 383 Effective search space: 118347 Effective search space used: 118347 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory