Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_068003520.1 PsAD2_RS05450 DctP family TRAP transporter solute-binding subunit
Query= SwissProt::Q9KQR9 (332 letters) >NCBI__GCF_001623255.1:WP_068003520.1 Length = 337 Score = 380 bits (975), Expect = e-110 Identities = 187/324 (57%), Positives = 237/324 (73%) Query: 7 LIAASILAVTSFNAAANCDPGEIVIKFSHVTNTDKHPKGIAASLLEKRVNEEMNGKACMQ 66 ++A I+ A +C PGE+VIKFSHV HPKG A +L +RVN E+NGKACMQ Sbjct: 9 ILALGIVFGAPAFAQIDCKPGEVVIKFSHVVPPSGHPKGDFARMLAERVNTELNGKACMQ 68 Query: 67 VFPNSTLYDDDKVLEALLNGDVQLAAPSLSKFEKFTKKYRIFDLPFLFEDVDAVDRFQSS 126 VFP S LYDD+KV+EAL+ GDVQLAAPSLSK E +T KYR+FDLPFLFED+DAV RF +S Sbjct: 69 VFPFSQLYDDEKVMEALILGDVQLAAPSLSKLEVYTNKYRLFDLPFLFEDMDAVQRFTAS 128 Query: 127 AKGEELKNAMTRRGVKGLEFWHNGMKQISANKPILVPADAKGLKFRVQASDVLVAQFEQI 186 KG+EL M+ GV GL + +G+K SA+KP+LVP+D GLKFRVQ SDV VA E + Sbjct: 129 EKGQELLGVMSDFGVVGLGYLFDGLKHFSADKPLLVPSDGAGLKFRVQNSDVAVAMIEAM 188 Query: 187 GANPQKMSFAETYGGLQTKVIDGQENTWSNIYGQKYFEVQDGTTETNHGILDYLVVTSSK 246 GA+ QK++F E YG LQ V+DGQEN+WSNI+ ++FEVQDGTTETNH +L Y+V T + Sbjct: 189 GASAQKLAFKEVYGALQLGVVDGQENSWSNIFTSRFFEVQDGTTETNHQLLAYVVFTPQE 248 Query: 247 WWDGLPADVRDQFAKILNEVTIERNAESNKVEELNKQYIIEAGGVVRTLTPEQRQQWVDA 306 W + L DVR+ F I E ++ N ++ K E+N+Q I++AG VR LTP+QRQQWVD Sbjct: 249 WLESLEPDVRELFLTIFRETLVKANGQAAKTSEVNRQRIVDAGYTVRELTPKQRQQWVDV 308 Query: 307 LKPVWQKFEKDIGADLIEAALAAN 330 ++PVW FE +IG DLI+AA AAN Sbjct: 309 MRPVWGDFEDEIGKDLIDAAEAAN 332 Lambda K H 0.316 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 337 Length adjustment: 28 Effective length of query: 304 Effective length of database: 309 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory