Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate WP_068009667.1 PsAD2_RS19325 ribose ABC transporter permease
Query= CharProtDB::CH_014278 (328 letters) >NCBI__GCF_001623255.1:WP_068009667.1 Length = 314 Score = 203 bits (516), Expect = 5e-57 Identities = 108/295 (36%), Positives = 172/295 (58%), Gaps = 4/295 (1%) Query: 28 LVVFAVLFIACAIFVPNFATFINMKGLGLAISMSGMVACGMLFCLASGDFDLSVASVIAC 87 L+ +L A + NF NM + S++ ++A GM F + + DLSV S++A Sbjct: 13 LIGLIILMAAVSFANANFLGVDNMLNILRQTSINAVIAMGMTFVILTSGIDLSVGSILAF 72 Query: 88 AGVTTAVVINLTESLWIGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATMQIVRGLAY 147 AG A +I + L + + A +++G G +G +I+ + I TL M ++RG Sbjct: 73 AGAICASLIGMDTPLVVALFATIMVGAGLGATSGVIISYFNVQPFIATLVGMTMIRGATL 132 Query: 148 IISDGKAV--GIED--ESFFALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRNTLAI 203 + + G+ V G D ESF+ G FG+P P+ L + I +L++T FGR AI Sbjct: 133 VYTQGRPVSTGSHDVAESFYQFGAGYIFGIPHPVILMIVIFAICWFILSQTRFGRYVYAI 192 Query: 204 GGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILASRMTSGQPMTSIGYELIVISACV 263 GGNE ARL+G+ V + KI+++ LSG ++A+AGIIL +R+ S QP +GYEL I+A V Sbjct: 193 GGNENVARLSGINVKKVKILVYALSGALAALAGIILTARLESAQPTAGLGYELDAIAAVV 252 Query: 264 LGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISPFAQYVVRGLILLAAVIFD 318 LGG SL GG G++ + G LI+G + NA+N++++S + Q + +G ++L AV+ D Sbjct: 253 LGGTSLAGGKGRVFGTIIGALIIGVLNNALNIMDVSSYYQMIAKGAVILLAVVVD 307 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 314 Length adjustment: 28 Effective length of query: 300 Effective length of database: 286 Effective search space: 85800 Effective search space used: 85800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory