Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_068000895.1 PsAD2_RS01040 ABC transporter permease subunit
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_001623255.1:WP_068000895.1 Length = 400 Score = 62.0 bits (149), Expect = 2e-14 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 4/126 (3%) Query: 86 AFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFEAAYSQGFGKFFTLFYIILPQTFRKIIP 145 A W S+Y+ + +AEI+R G+ +I KGQ EAA + G T+ ++LPQ R IIP Sbjct: 270 ALW--FALSIYSGAFIAEIVRAGIMAISKGQSEAASALGLRPNRTMSLVVLPQALRIIIP 327 Query: 146 ALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKLTSFEEILAMIGVVAGIYFIICFSLS 205 ++S + K+++ +G +LT I T E+ M+ ++A Y +I S+S Sbjct: 328 PMISNYLNITKNSSLAIAVGYMDLTGTLGGITLNQTG-REMECMLLLMA-TYLVISLSIS 385 Query: 206 MLVRYY 211 ++ Y Sbjct: 386 GVMNAY 391 Score = 40.8 bits (94), Expect = 4e-08 Identities = 23/56 (41%), Positives = 31/56 (55%) Query: 16 GLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLLWMLA 71 GL TL +AL C+ + V G F I + + + L A YI+ RN PLLL +LA Sbjct: 91 GLLNTLLVALLACVSATVLGVFAGILRLSNNWVVSRLMAVYIEGVRNVPLLLQILA 146 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 219 Length of database: 400 Length adjustment: 26 Effective length of query: 193 Effective length of database: 374 Effective search space: 72182 Effective search space used: 72182 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory