Align GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)
to candidate WP_068006976.1 PsAD2_RS14030 ABC transporter ATP-binding protein
Query= TCDB::Q88P35 (384 letters) >NCBI__GCF_001623255.1:WP_068006976.1 Length = 361 Score = 321 bits (822), Expect = 2e-92 Identities = 176/366 (48%), Positives = 237/366 (64%), Gaps = 6/366 (1%) Query: 1 MATLELRNVNKTYGSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGG 60 M ++E+++++ +G + LK++ LSI GEFL+L+G SGCGKSTL+NC+AGL ++ G Sbjct: 1 MNSIEIKDLSLRFGE--VEVLKNLNLSIHKGEFLVLLGSSGCGKSTLLNCVAGLLDLSHG 58 Query: 61 AILIDEQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKLPQAAIDEEVARVA 120 I IDE++V+ PKDR I MVFQSYALYP MSVR N+ FGLK +P+A I + + R A Sbjct: 59 QIFIDERNVTWEEPKDRGIGMVFQSYALYPQMSVRGNLSFGLKNAGIPKAEIAKRIQRAA 118 Query: 121 KLLQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 ++LQI+ LL RKPA LSGGQ+QRVA+GRAL R ++LFDEPLSNLDAKLR ++R E+ Sbjct: 119 EILQIQDLLHRKPAALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRADLRVEINR 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFIGSPP 240 +H RLK T +YVTHDQIEAMTL D++AVM+DG I Q P QIYN P N+++A FIGSP Sbjct: 179 LHHRLKNTMIYVTHDQIEAMTLADRIAVMRDGNILQLDVPSQIYNRPINKYIAGFIGSPS 238 Query: 241 MNFIPVRLARQDGRLLALLDSGQARCELPLGE-AADALEGREIILGIRPEQIALGAADGN 299 MNF+ +L+ D G R ++ + + LG+RPE I G A Sbjct: 239 MNFLEGKLSAGDNPSFIF---GDERFDMSRYRFDGEGQQNGATTLGVRPEHIRTGNAAQE 295 Query: 300 GLPAIRAEVQVTEPTGPDLLVFVTLNQTKVCCRLAPDVACRVGDTLNLQFDPARVLLFDA 359 + V+V EP G D LV L + R+ + GD L + FDPA+V LF+ Sbjct: 296 MPISRNIVVEVVEPMGSDTLVRTHLAGQEFRLRMDGLASVNKGDNLLVGFDPAQVSLFET 355 Query: 360 ANGERL 365 + +RL Sbjct: 356 TSEQRL 361 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 361 Length adjustment: 30 Effective length of query: 354 Effective length of database: 331 Effective search space: 117174 Effective search space used: 117174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory