Align deoxynucleoside transporter, ATPase component (characterized)
to candidate WP_068009665.1 PsAD2_RS19320 ATP-binding cassette domain-containing protein
Query= reanno::Burk376:H281DRAFT_01113 (515 letters) >NCBI__GCF_001623255.1:WP_068009665.1 Length = 497 Score = 315 bits (808), Expect = 2e-90 Identities = 179/491 (36%), Positives = 290/491 (59%), Gaps = 9/491 (1%) Query: 16 LEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQLVIE 75 LE+ G+ K F+G++ L+ V L+ + G++ L GENG GKSTL+KIISG D G + + Sbjct: 5 LELQGIEKSFSGINVLKSVDLTIRAGRVVALAGENGAGKSTLMKIISGIYQRDAGTVFYK 64 Query: 76 GVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTFDRRVLAA 135 G +A E++ AGI ++Q+L+LLP++SVAEN+ L E T G++ +R Sbjct: 65 GHEVEFTNARESMDAGIGIIHQELNLLPDLSVAENIYLGRE-PTKLGKIQWDVVQRESKK 123 Query: 136 TAARALEAVGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEV 195 A+ + + +T + +L +A +Q+V IA+A++ A+ +IMDEPT +LT E Sbjct: 124 YLAQLKQDID-------PTTPLGKLSIAQQQMVEIAKALSLNAEVIIMDEPTDALTDIET 176 Query: 196 DNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFTKAQISELM 255 L V+ LRAQG ++F+SH+L E + + ++ +LRDGQ + QG +A+ ++ + M Sbjct: 177 AILFEVVDELRAQGKGLVFISHRLGEIFQMCDDIAILRDGQMVHQGAVADISEDDLIRHM 236 Query: 256 TGRHLSNERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDSGRNELAR 315 GR LS++ A D+ ++V T G ++SF + GE++G GL+ +GR ELA+ Sbjct: 237 VGRELSDQYPFVPAEPGDVRIEVDKLTARGA-KEISFTANAGEVVGFAGLVGAGRTELAK 295 Query: 316 ALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIRDNVITAMI 375 A+ G P + G V +DGQ+I+L++P D + +IGYV EDR EGL + + N+ + Sbjct: 296 AIFGANPIRGGSVKIDGQEISLKSPQDGVKAKIGYVTEDRKQEGLVQSQSLGSNMSLTGL 355 Query: 376 SSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGRWLAIDPRV 435 + G +++T + ++ I T + +LSGGNQQ+V I + L +P V Sbjct: 356 DRFCNTLGIVNKTSEAVTISEYIEAFAIKTRDASTIISNLSGGNQQKVSIAKSLVPEPEV 415 Query: 436 LILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGHVSAE 495 LIL PT GVDVG+K IY ++ +L G+ I+LIS D+PELL DRIL++ G ++ Sbjct: 416 LILDEPTRGVDVGAKREIYTLINKLKAEGLCILLISSDMPELLGISDRILVLSDGKLTGS 475 Query: 496 YRADELSEADL 506 + DE ++ ++ Sbjct: 476 FDRDEATQENI 486 Lambda K H 0.319 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 587 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 497 Length adjustment: 34 Effective length of query: 481 Effective length of database: 463 Effective search space: 222703 Effective search space used: 222703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory