Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate WP_068004602.1 PsAD2_RS07585 NADP-dependent malic enzyme
Query= metacyc::PTACLOS-MONOMER (333 letters) >NCBI__GCF_001623255.1:WP_068004602.1 Length = 760 Score = 167 bits (422), Expect = 1e-45 Identities = 108/324 (33%), Positives = 171/324 (52%), Gaps = 12/324 (3%) Query: 4 IESIWECAKQDKKRIILAEGEEKRNLIAADKIIKEGLAELVLVGDENKIKEKASELNLDI 63 ++ I +Q+ KRI+ AEGEE + AA + +GL E +LVG E++I A+ +D+ Sbjct: 440 LQRIISKVRQNPKRIVFAEGEEPAVIRAASAFVSQGLGEAILVGREDEILANATSAGIDV 499 Query: 64 SKAEIM--DPETSLKTETYARDFYELRKHKGMTIEKSEKMV-RDPLYFATMALKDGYVDG 120 S+ I +S + YA Y + KG +++V D Y+A++ + G DG Sbjct: 500 SRPGIRLESARSSTRNADYAEYLYSRLQRKGYLQRDCQRLVNNDRNYWASIMVALGDADG 559 Query: 121 MVSGAVHTTGDLLRPGLQIIKTAPGVKIVSGFFVMIIPDCDYGEEGLLLFADCAVNPNPT 180 +V+G L + I T PG +++ G ++I P +L AD AV+ PT Sbjct: 560 VVTGTTRNYSVALETVSRCIDTKPGHRVI-GVSIVITPG------KTVLVADTAVHDMPT 612 Query: 181 SDELADIAITTAETARKLCNVEPKVAMLSFSTMGSAKGEMVDKVKNAVEITKKFRPDLAI 240 S+ELADIA A AR+L EP++AML++ST G +GE ++++ AV+I + R D Sbjct: 613 SEELADIAEEAAHVARRL-GSEPRIAMLAYSTFGHPRGERTERLQEAVKILDRRRVDFEY 671 Query: 241 DGELQLDAAIDSEVAALKAPSSNVAGNANVLVFPDLQTGNIGYKLVQRFAKAKAIGPICQ 300 DGE+ D A++ E + P + G ANVLV P + +I KL++ + IGP+ Sbjct: 672 DGEMGADIALNMEKMS-AYPFCRLNGPANVLVMPAFHSASIATKLLEELGGSTLIGPLLV 730 Query: 301 GFAKPINDLSRGCSSEDIVNVVAI 324 G KP+ + G +I N+ AI Sbjct: 731 GMDKPVQIVPMGAKDSEIFNMAAI 754 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 760 Length adjustment: 34 Effective length of query: 299 Effective length of database: 726 Effective search space: 217074 Effective search space used: 217074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory