Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_068000560.1 PsAD2_RS00560 ABC transporter permease
Query= uniprot:D8J112 (347 letters) >NCBI__GCF_001623255.1:WP_068000560.1 Length = 332 Score = 224 bits (570), Expect = 3e-63 Identities = 123/307 (40%), Positives = 190/307 (61%), Gaps = 12/307 (3%) Query: 42 SLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCA 101 +LL +ILFFS + +F+ +N+ +IL +N +LA+ T+VI+ GIDLSVG++M F + Sbjct: 30 ALLALILFFSIFTEHFLTANNITNILTQVTINLILAVGMTFVILIGGIDLSVGSVMAFAS 89 Query: 102 VMAGVVLTNWGM----PLPLGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKG 157 V+AG +T G+ + L + AA G + G I+G + A+ +P FI TLGM+ + +G Sbjct: 90 VIAGKAITLAGLGPFEAIVLAVIAATAVGVVCGAINGTITARWSLPSFIITLGMLNIARG 149 Query: 158 LSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVF 217 +L S + IY + F G +P ++ + A ILN TVF Sbjct: 150 AALQASNAQTIY-SFPLAFEDFGSAMFYG-------VPVVFMVALALVFIAWFILNFTVF 201 Query: 218 GRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYEL 277 GR + +G+NEEA+RL+G V +K+A +T G GIA ++ +RLN + P G G+EL Sbjct: 202 GRLLYGIGNNEEAVRLAGHSVYRYKIAAFTICGLTAGIAAVVYMARLNISSPIAGIGFEL 261 Query: 278 DAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVY 337 +AIAAV+IGGTSL+GG G+++GT+IGAFI+ VL NGL ++ ++ + ++TGV+II+AV Sbjct: 262 NAIAAVIIGGTSLNGGRGSVIGTLIGAFIIGVLANGLILIGLSDFMRQMITGVVIIIAVI 321 Query: 338 LDILRRR 344 LD R + Sbjct: 322 LDYYRAK 328 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 332 Length adjustment: 28 Effective length of query: 319 Effective length of database: 304 Effective search space: 96976 Effective search space used: 96976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory