Align Monosaccharide-transporting ATPase; EC 3.6.3.17 (characterized, see rationale)
to candidate WP_068009667.1 PsAD2_RS19325 ribose ABC transporter permease
Query= uniprot:B2SYR4 (338 letters) >NCBI__GCF_001623255.1:WP_068009667.1 Length = 314 Score = 218 bits (556), Expect = 1e-61 Identities = 104/301 (34%), Positives = 181/301 (60%), Gaps = 4/301 (1%) Query: 33 ITEYSLIVIFVVMFATMSLTVDHFFSIENMLGLALSISQIGMVSCTMMFCLASRDFDLSV 92 I+E ++ +++ A +S +F ++NML + S +++ M F + + DLSV Sbjct: 7 ISENKSLIGLIILMAAVSFANANFLGVDNMLNILRQTSINAVIAMGMTFVILTSGIDLSV 66 Query: 93 GSTVAFAGVLCAMVLNATGNTFIAIVAAVAAGGVIGFVNGAVIAYLRINALITTLATMEI 152 GS +AFAG +CA ++ +A+ A + G +G +G +I+Y + I TL M + Sbjct: 67 GSILAFAGAICASLIGMDTPLVVALFATIMVGAGLGATSGVIISYFNVQPFIATLVGMTM 126 Query: 153 VRGLGFIVSHGQAVGVSS----DTFIALGGLSFFGVSLPIWVTLLCFIVFGVMLNQTVYG 208 +RG + + G+ V S ++F G FG+ P+ + ++ F + +L+QT +G Sbjct: 127 IRGATLVYTQGRPVSTGSHDVAESFYQFGAGYIFGIPHPVILMIVIFAICWFILSQTRFG 186 Query: 209 RNTLAIGGNPEASRLAGINVERTRVYIFLIQGAVTALAGVILASRITSGQPNAAQGFELN 268 R AIGGN +RL+GINV++ ++ ++ + GA+ ALAG+IL +R+ S QP A G+EL+ Sbjct: 187 RYVYAIGGNENVARLSGINVKKVKILVYALSGALAALAGIILTARLESAQPTAGLGYELD 246 Query: 269 VISACVLGGVSLLGGRATISGVVIGVLIMGTVENVMNLMNIDAFYQYLVRGAILLAAVLL 328 I+A VLGG SL GG+ + G +IG LI+G + N +N+M++ ++YQ + +GA++L AV++ Sbjct: 247 AIAAVVLGGTSLAGGKGRVFGTIIGALIIGVLNNALNIMDVSSYYQMIAKGAVILLAVVV 306 Query: 329 D 329 D Sbjct: 307 D 307 Lambda K H 0.326 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 314 Length adjustment: 28 Effective length of query: 310 Effective length of database: 286 Effective search space: 88660 Effective search space used: 88660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory