Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate WP_074882195.1 PsAD2_RS21425 sugar porter family MFS transporter
Query= SwissProt::P96710 (464 letters) >NCBI__GCF_001623255.1:WP_074882195.1 Length = 448 Score = 239 bits (609), Expect = 2e-67 Identities = 144/454 (31%), Positives = 237/454 (52%), Gaps = 19/454 (4%) Query: 23 VILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFMEGLVISSIMIGGVVGVGISGF 82 +I I+ L G L GY+ V+SGA L + +PF+ G+V S++ +GG++G + + Sbjct: 2 LIFITGIVVLCGFLSGYNGGVVSGAYSLLVQQFHFTPFLGGVVASALPLGGLLGSIFASY 61 Query: 83 LSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGMGSSLSVTYITEAA 142 SD GRR ++ +A LF + A++S + V TLIIAR + G G+ + + Y++E A Sbjct: 62 SSDHMGRRTSILISASLFVVGALMSGTTNHVETLIIARFLVGFATGIVTPIGPQYLSEIA 121 Query: 143 PPAIRGSLSSLYQLFTILGISATYFINLAVQRSG-TYEWGVHTGWRWMLAYGMVPSVIFF 201 PP +RG + YQ+ T G+ + Y N + SG + ++ V W+ M A +P+V+ Sbjct: 122 PPLVRGRMIGAYQMMTSGGVLSAYVANQII--SGISADFDVINRWQLMFALSGIPAVVLL 179 Query: 202 LVLLVVPESPRWLAKAGKTNEALKILTRINGETVAKEELKNIENSLKIEQMG----SLSQ 257 + +L P SPRWL G+ +A ++ + + K + ++ E+ Sbjct: 180 VGMLFAPRSPRWLLLRGRNQDAREVFYMLGSKGAEDWGEKAVNTAINEERSTRGTCRWRD 239 Query: 258 LFKPGLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFG-QNAGFVTTCIVGVVEVI 316 L P LR + I + + Q+ G+N + YY P+I +GF + T +GVV + Sbjct: 240 LIGPELRSITIFAIAIFVIQQLSGINVVIYYAPQILSQLGFALHETSLLATTSLGVVMFL 299 Query: 317 FTVIAVLLIDKVGRKKLMSIGSAFMAIFMILIGTSFYFELTSGIMMIVLILG---FVAAF 373 ++ A+ L DK GR+ L+ IG IL Y E +G + + LG ++AAF Sbjct: 300 TSIPALFLFDKFGRRSLLIIGLPLCGFAEILAMVPVYLE--NGELAWLGALGLCLYMAAF 357 Query: 374 CVSVGPITWIMISEIFPNHLRARAAGIATIFLWGANWAIGQFVPMMIDSFGLAYTFWIFA 433 +S+GP+ WI I+EIFP RA+ I + W N+ + P++I SFG+ FW+FA Sbjct: 358 ALSIGPLPWIYIAEIFPVQARAKGMVIGVMTNWIFNFGVVLMFPVLIASFGI---FWMFA 414 Query: 434 VINILCFL---FVVTICPETKNKSLEEIEKLWIK 464 + CFL + V PETK +E+I++L+ K Sbjct: 415 MFITTCFLGMCYAVRYAPETKGVPIEQIQQLFRK 448 Lambda K H 0.327 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 448 Length adjustment: 33 Effective length of query: 431 Effective length of database: 415 Effective search space: 178865 Effective search space used: 178865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory