Align Solute-binding (Aliphatic amino acid) component of ABC transporter (characterized, see rationale)
to candidate WP_068001888.1 PsAD2_RS02810 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:Q1MDE9 (367 letters) >NCBI__GCF_001623255.1:WP_068001888.1 Length = 366 Score = 284 bits (726), Expect = 3e-81 Identities = 147/352 (41%), Positives = 214/352 (60%), Gaps = 3/352 (0%) Query: 11 VASLAFAPLAHADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILGEKVVLELA 70 VA++A + A ADI +G P+TG A++G Q+K GA+ AV +IN GG+ GE +VLE+ Sbjct: 12 VAAMAISGAAMADIIVGTAGPMTGQYASFGAQMKAGAEQAVADINAAGGVNGEMLVLEVG 71 Query: 71 DDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTATAPDLT-K 129 DDA +PKQ V+ AN++VG + F+ G SG +IP S V AE G++ +TP +T P T + Sbjct: 72 DDACDPKQAVAVANQMVGKNVAFMAGHFCSGSSIPASQVYAEEGIIQITPASTNPKYTDE 131 Query: 130 RGLTNVLRTCGRDDQQAEVAAKYVLKNFKDKRVAIVNDKGAYGKGLADAFKATLNAGGIT 189 R R CGRDDQQ VA + F DK +A+++DK AYGKGLADA KA +NA G Sbjct: 132 RAGPGTFRVCGRDDQQGRVAGTTLATEFGDKNIAVIHDKTAYGKGLADATKAVMNAAGKE 191 Query: 190 EVVNDAITPGDKDFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDLAANATIIGGDGL 249 E + +A T G+KD++AL +++KSEKVDV+Y GGYH E GL+ RQ+ D + ++ GD L Sbjct: 192 EALYEAYTAGEKDYTALVSKLKSEKVDVLYVGGYHTEAGLMKRQMVDQGMDTILVSGDAL 251 Query: 250 SNTEFWAIGTDAAGGTIFTNASDATKSPDSKAAADALAAKNIPAEAFTLNAYAAVEVLKA 309 E+W+I A GT+ T D + ++ A AL A E + L YAA++ Sbjct: 252 VTDEYWSITGPAGAGTLMTFPPDPRSNEEAAAVVAALEAAGKTTEGYALYTYAAIQTWAK 311 Query: 310 GIEKAGSAEDAEAVATALKDGKEIPTAIGKVTYGETGDLTSQSFSLYKWEAG 361 AGS D + V L + ++ T +G++++ E GD+T + Y+W+ G Sbjct: 312 AAAAAGST-DYDTVVEKL-NSEKFDTVLGELSFDEKGDVTLPGYVWYEWKDG 361 Lambda K H 0.312 0.131 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 366 Length adjustment: 30 Effective length of query: 337 Effective length of database: 336 Effective search space: 113232 Effective search space used: 113232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory