Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_068001529.1 PsAD2_RS02130 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_001623255.1:WP_068001529.1 Length = 670 Score = 389 bits (1000), Expect = e-112 Identities = 206/486 (42%), Positives = 306/486 (62%), Gaps = 8/486 (1%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 FS++L+ANRGEIA RV+K K MG+ +AVYS+AD+ A+H + ADEA +IG+ A SYL Sbjct: 2 FSKILIANRGEIACRVIKTAKAMGIKTVAVYSDADRDALHVEMADEAVHIGEPTAAKSYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 I+ IIDA ++ +A+HPGYGFLSE AEF E +++ GI FIGP+ + + + DK+ KR Sbjct: 62 VIDKIIDACKQTGAEAVHPGYGFLSERAEFCERLKQEGIVFIGPNPKAIEVMGDKITSKR 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 A A V T PG G + + +A ++A ++GYP+M+KA++GGGG G+ N ++ MD + Sbjct: 122 FAAEANVSTVPGYMGLIETPQDAKRIAAEVGYPVMIKASAGGGGKGMRIAWNDEEAMDGF 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 +R K A +FG +FIEK+ NPRHIE Q++GDK+GN V EREC+IQRRNQK+IEE Sbjct: 182 DRAKSEAINSFGDDRIFIEKFIENPRHIEIQVMGDKHGNAVYLGERECSIQRRNQKVIEE 241 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 APSP L + R M E + K ++Y + GT E + + F+FLE+N RLQVEHP T Sbjct: 242 APSPLLDEKTRRKMGEQAVALAKAVDYDSAGTVEFV-AGQDKSFFFLEMNTRLQVEHPVT 300 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 EL+ +DLV+ I++AAGE L QED+ ++ G +IE RI AED NF S G +T+Y Sbjct: 301 ELVTGVDLVEQMIRVAAGEALSIKQEDV--KLNGWSIESRIYAEDPYRNFLPSIGRLTHY 358 Query: 364 REPTGPG-----VRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIG 418 R P VR D+G+ GS + +YD +++KL+ + +R AI+ AL ++++ Sbjct: 359 RPPVEGKHGNYLVRNDTGVVEGSEISMFYDPMIAKLVTHAATRAEAIEGMSTALDEFQVD 418 Query: 419 GIKTTIELYKWIMQDPDFQEGKFSTSYISQKTDQFVKYLREQEEIKAAIAAEIQSRGLLR 478 GI+ + +M+ P ++ G+ ST +I+ + + E + +A+ S L+ Sbjct: 419 GIQHNVPFLASLMKHPRWRSGEISTGFIADEYPDGFEPATPDAEANSVLASVALSMHLIE 478 Query: 479 TSSTDN 484 D+ Sbjct: 479 RERLDH 484 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 732 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 670 Length adjustment: 36 Effective length of query: 473 Effective length of database: 634 Effective search space: 299882 Effective search space used: 299882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory