Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate WP_068006840.1 PsAD2_RS13785 4-oxalomesaconate tautomerase
Query= SwissProt::A0A0U2X0E4 (443 letters) >NCBI__GCF_001623255.1:WP_068006840.1 Length = 366 Score = 238 bits (606), Expect = 3e-67 Identities = 132/324 (40%), Positives = 188/324 (58%), Gaps = 10/324 (3%) Query: 11 RAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKVAIVSASTQR 70 R GTSRG YF DLP + + ++AL+S+MG+GHPL IDG+GGG +T+KVAI+S ST Sbjct: 12 RGGTSRGAYFQRKDLPEDETLLESALLSVMGAGHPLNIDGIGGGAEVTTKVAILSPSTDP 71 Query: 71 SEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTCLVRIFNLNS 130 S DVDYLF Q+ +R VD P CGN+++GV AIE GLV+ T +R N + Sbjct: 72 ST-DVDYLFAQIDGHKRIVDFGPTCGNILAGVGPAAIEMGLVEAQNYITHVKIRAVNTGA 130 Query: 131 RQASELVIP----VYNGRVHYDDIDDMHMQRPSARVGLRFLDTVGSCTGKLLPTGNASDW 186 +++ P Y G H D + +A + + F + GS TGK+LPTG Sbjct: 131 HITAKVKTPDKCVEYEGATHIDGVPGT-----AASIVMEFREVAGSSTGKILPTGQPRTI 185 Query: 187 IDGLKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRRMGLGDV 246 IDGL+VS +D A+P+V +R D+ I+G E+ L AN L+ RL + ++AG+ MGLGD Sbjct: 186 IDGLEVSCVDVAMPLVLVRASDINISGYESVDELAANKELMARLASIHIKAGQLMGLGDT 245 Query: 247 SGSVVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVCEILSSR 306 S V+PK + + E TARYFTP A H + A+TGA C A + +G++ + + Sbjct: 246 SRQVIPKFAALAMAREGGDITARYFTPWAPHPSMALTGAQCIATSMLYEGTIAVDFYTPP 305 Query: 307 ASACSASQRRISIEHPSGVLEVGL 330 + I IEHP G ++V + Sbjct: 306 VNHSDNQPIAIQIEHPCGHIDVAV 329 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 366 Length adjustment: 31 Effective length of query: 412 Effective length of database: 335 Effective search space: 138020 Effective search space used: 138020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory