Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_068010535.1 PsAD2_RS21535 carbohydrate ABC transporter substrate-binding protein
Query= uniprot:A0A165KPY4 (416 letters) >NCBI__GCF_001623255.1:WP_068010535.1 Length = 415 Score = 389 bits (1000), Expect = e-113 Identities = 187/404 (46%), Positives = 271/404 (67%), Gaps = 3/404 (0%) Query: 7 IAAVAVGLAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKGHTWRDFAVAGGGGDS 66 + A+AV ++ + +A EVLH+WT+GGEA++ LK+ + +G W D VAGGGGD+ Sbjct: 8 LVALAVLFSSITAQAAPTAEVLHFWTAGGEARATRALKQAFEARGGVWDDAPVAGGGGDA 67 Query: 67 AMTVLKSRVISGNPPSAAQTKGPAIQEWASEGVLANMDTLAKAEKWDELLPKVVADVMKY 126 VL++RV++ PPS Q KG IQEWA+ G L +D A+ + WD+LLP+++ + ++Y Sbjct: 68 MAAVLRARVLAKVPPSIVQIKGQNIQEWAAVGALEALDVTAQKQNWDKLLPELLKETVQY 127 Query: 127 KGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVPVAHGGQN 186 +G YVA P+N+HRV+W+W + + L + GV P+TWDEF ADK+KAAG++P+AHGGQ Sbjct: 128 QGKYVAVPLNIHRVDWIWANPKVLDQVGVTP-PQTWDEFNEVADKIKAAGIIPLAHGGQP 186 Query: 187 WQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDPGAPGRDW 246 WQD T FE V+LG+GGA FY+ + LD AL SDTM K + R++ Y DPGAPGR+W Sbjct: 187 WQDITLFEVVLLGIGGADFYKKVYLDLDQEALRSDTMVKVFDQMRKLSTYVDPGAPGREW 246 Query: 247 NLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVDSFILFKL 306 NLATAM+++G+A Q+MGDWAK EFL AG G+DF+C ++P S + N DSF +FK+ Sbjct: 247 NLATAMVMRGEAAMQIMGDWAKAEFLTAGLKYGEDFICVSSP-SKGGYIINSDSFAMFKI 305 Query: 307 KDAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKDFVDTAKS 366 + + Q +AS ++ Q+ FNL KGSIP R G +D FD+CAK S++D + Sbjct: 306 SEPEQKAGQQLMASMLLDEQVQKDFNLLKGSIPARLGVSLDGFDECAKKSSEDLILNEAR 365 Query: 367 GGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKKIA 410 G +V S AH + + A GA DVV++ +N D +S +A+ ++A Sbjct: 366 GTVVGSIAHELVQSGAVRGAFLDVVTEHFNTD-MSSQEAVNQLA 408 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 415 Length adjustment: 31 Effective length of query: 385 Effective length of database: 384 Effective search space: 147840 Effective search space used: 147840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory