Align GtsB (GLcF), component of Glucose porter, GtsABCD (characterized)
to candidate WP_068006979.1 PsAD2_RS14040 sugar ABC transporter permease
Query= TCDB::Q88P37 (302 letters) >NCBI__GCF_001623255.1:WP_068006979.1 Length = 297 Score = 258 bits (658), Expect = 2e-73 Identities = 122/279 (43%), Positives = 177/279 (63%) Query: 22 KLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPTYKWAGLAQYARLFDNDRWWVASKNL 81 K+ P + LV F G +WT V SFT S LP + GL QY RLF RW ++ +N+ Sbjct: 17 KIAALPMIATTLVVFLGCSIWTVVYSFTKSRSLPLNDFVGLMQYERLFRTSRWLISLENI 76 Query: 82 LLFGGLFIAISLAIGVLLAVLLDQRIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMG 141 +++G + S +G +LA L+DQ+IR E RTI+LYP ALS IVTG W+W+LNP MG Sbjct: 77 VIYGVFALVFSFVVGFVLAALIDQKIRFESTFRTIFLYPFALSFIVTGVVWQWILNPTMG 136 Query: 142 LDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDPSIIRAAQ 201 L +R GWE F D + D V+Y L+IA +WQ +GF+M + LAG+R D I +AA+ Sbjct: 137 LQASIRSMGWESFTFDLIAGRDTVIYALLIAGLWQGTGFVMVLMLAGIRSTDDEIWKAAR 196 Query: 202 MDGASLPRIYWTVVLPSLRPVFFSALMILSHIAIKSFDLVAAMTAGGPGYSSDLPAMFMY 261 +DG + Y +V+P +R V + L+I++ +K +DLV AMT GGPG SS++PA ++Y Sbjct: 197 IDGIPTWKTYLFIVIPMMRGVIMTTLVIVAAGIVKLYDLVVAMTQGGPGISSEVPAKYVY 256 Query: 262 SFTFSRGQMGMGSASAILMLGAILAILVPYLYSELRSKR 300 F F+RG +G G A++ +ML +L I++P+ Y E K+ Sbjct: 257 DFMFARGNLGQGLAASTVMLTTVLIIIIPWAYLEYGRKK 295 Lambda K H 0.330 0.142 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 297 Length adjustment: 27 Effective length of query: 275 Effective length of database: 270 Effective search space: 74250 Effective search space used: 74250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory