Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_068010540.1 PsAD2_RS21550 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_001623255.1:WP_068010540.1 Length = 370 Score = 304 bits (779), Expect = 2e-87 Identities = 159/331 (48%), Positives = 221/331 (66%), Gaps = 14/331 (4%) Query: 1 MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDL 60 M+ + + KS+G +V+K + LD+K GEF+V +G SGCGKSTLL +IAGLE ++ G + Sbjct: 1 MATISIEHASKSFGSTKVLKDISLDVKDGEFLVLLGASGCGKSTLLNIIAGLEPMADGTI 60 Query: 61 TIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAHI 120 +D +NDV P R IAMVFQSYALYP+MTV N+ F L + +AE + V E A Sbjct: 61 RLDGEVVNDVHPKNRDIAMVFQSYALYPNMTVERNIAFGLEMRKISKAERKATVREVAST 120 Query: 121 LELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARLH 180 L++ LL RKP QLSGGQRQRVA+GRA+VR PKIFLFDEPLSNLDA+LR MR EI +LH Sbjct: 121 LQIEHLLSRKPSQLSGGQRQRVAMGRALVRRPKIFLFDEPLSNLDAKLRGEMRTEIKKLH 180 Query: 181 KQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSPKMN 240 + L T+VYVTHDQ+EAMTLAD+I +M+ G ++Q+G+P ++Y PAN++VAGF+G+P MN Sbjct: 181 QTLKATMVYVTHDQIEAMTLADRIAIMKDGEIQQIGTPQEIYSKPANMYVAGFVGAPPMN 240 Query: 241 FLKGVIEIDEDQAYARLP-----DYGDAKIPVT----LQAAAGTAVTIGIRPEHFDE--- 288 F++ + E+Q A LP + D +P+ L+A T V +G+RPE + Sbjct: 241 FVEVDLVKREEQLGAILPAVLKGEPVDHFLPLPNSKHLEARENTKVILGLRPEIITDSTS 300 Query: 289 --AGPAALDLAIDMLEHLGGETFAYARHHGN 317 + ++ ++ LE G +T R +G+ Sbjct: 301 THSSAPEIECDVEFLEPTGADTLCIIRLNGH 331 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 370 Length adjustment: 29 Effective length of query: 329 Effective length of database: 341 Effective search space: 112189 Effective search space used: 112189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory