Align Phosphoglucomutase/phosphomannomutase; PGM/PMM; EC 5.4.2.2; EC 5.4.2.8 (characterized)
to candidate WP_068004097.1 PsAD2_RS06585 phosphoglucosamine mutase
Query= SwissProt::Q68BJ6 (456 letters) >NCBI__GCF_001623255.1:WP_068004097.1 Length = 449 Score = 213 bits (543), Expect = 8e-60 Identities = 147/456 (32%), Positives = 231/456 (50%), Gaps = 18/456 (3%) Query: 3 KLFGTFGVRGIANE-EITPEFALKIGMAFGTLLKREGRERPLVVVGRDTRVSGEMLKDAL 61 K FGT G+RG AN +T E ALK+GMA G + +R G+ R VV+G+DTR+SG M+++AL Sbjct: 4 KYFGTDGIRGTANIWPMTAEVALKVGMAAGVVFRR-GKYRHRVVIGKDTRLSGYMIENAL 62 Query: 62 ISGLLSTGCDVIDVGIAPTPAIQWATNHFNADGGAVITASHNPPEYNGIKLLEPNGMGLK 121 ++G + G DV +G PTPA+ T AD G +I+ASHNP E NGIK P+G L Sbjct: 63 VAGFTAMGMDVFLLGPTPTPAVAMLTRSMRADIGVMISASHNPFEDNGIKFFGPDGFKLS 122 Query: 122 KEREAIVEELFFSE-DFHRAKWNEIGE-LRKEDIIKPYIEAIKNRVDVEAIKKRRPFVVV 179 E E +E L S+ + ++ +G R YIE K+ + + VV+ Sbjct: 123 DEVELQIERLIDSDMSLNLSEPGVVGRATRVASTRDRYIEFAKHTLP-RNLSLNGMRVVI 181 Query: 180 DTSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFG 239 D +NGA P +L ELG +V + P+G N + + + + V + AD G Sbjct: 182 DCANGAAYNVAPEILWELGAEVFPMGVDPNG--LNINKDCGSTSPEALAQKVHEVRADIG 239 Query: 240 VAQDGDADRAVFIDENGRFIQGDKTFALVADAVLREN--GGGLLVTTIATSNLLDDIAKR 297 +A DGDADR + +DE + + GD+ A++A++ E +V T+ ++ LD + Sbjct: 240 IALDGDADRVIIVDEKSKVVDGDQLMAVIAESWNEEGRLSAPGIVATVMSNLGLDRYLQT 299 Query: 298 NGAKVMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSG 357 G ++R KVGD V + E +GGE++G ++ DF DG + +I+ K Sbjct: 300 LGLTLVRAKVGDRYVVERMREIGFNVGGEQSGHIVMSDFGTTGDGLVAALQILACVKKMD 359 Query: 358 KKFSELIDELPKYYQFKTKRHVEGDRKAIVAKVAELAEKKGYKIDTTDGTKIIFDDGWVL 417 K SE+ + Q +G E + + G K + G ++ Sbjct: 360 KPVSEVCNRFVPVPQILINVRYKG---------GEPLNDESVQAVIKAGEKKLGKQGRLV 410 Query: 418 VRASGTEPIIRIFSEAKSEEKAREYLELGIKLLEEA 453 +RASGTEP+IR+ EA E+ + ++ + ++ A Sbjct: 411 IRASGTEPLIRVMGEADDEKLLHKVVDSIVSAVKAA 446 Lambda K H 0.317 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 449 Length adjustment: 33 Effective length of query: 423 Effective length of database: 416 Effective search space: 175968 Effective search space used: 175968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory