Align Putative enoyl-CoA hydratase protein; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_068010800.1 PsAD2_RS22250 enoyl-CoA hydratase
Query= uniprot:Q92VJ6 (261 letters) >NCBI__GCF_001623255.1:WP_068010800.1 Length = 261 Score = 256 bits (653), Expect = 4e-73 Identities = 134/261 (51%), Positives = 170/261 (65%) Query: 1 MTFDTIRCAIDQRGVARVTLARSEKHNALSATMIGELTAVVGRLATDASIRAVILDAEGK 60 MT+ +IR + G+ + LARSEKHNA+ A M+ EL V L RA+IL A+G Sbjct: 1 MTYQSIRIEKAENGITTLWLARSEKHNAICAQMMDELVEVAVHLDQCEQTRAIILAADGA 60 Query: 61 SFCAGGDLDWMRQQFSADRPTRIAEATRLAMMLKALNDLPKPLIARVHGNAFGGGVGLIS 120 +FCAGGDL WM++Q DR ++ EA RLA MLK L++L KPLIARVHG A+GGGVG++S Sbjct: 61 TFCAGGDLKWMQEQAEKDRIGKMQEANRLAGMLKRLDNLKKPLIARVHGPAYGGGVGILS 120 Query: 121 VCDTVIAASGAQFGLTETRLGLIPATISPYVIARTGEARARPLFMSARVFGAEEAKVAGF 180 VCD V+AA+ +F LTETRLGLIPATI PYV+ R GE AR +FM+AR FGAE A+ G Sbjct: 121 VCDLVVAANDTKFALTETRLGLIPATIGPYVVRRLGEGHARQVFMNARAFGAERAQQLGL 180 Query: 181 VTTVVDGTMLDGAVEAAVTAYLVAAPGAAGRAKRLARSLGLPITDAVIAATIEQLADTWE 240 V+ V L + AYL APGA AK L ++L D I + LAD WE Sbjct: 181 VSIVTTPEDLHKVAQKEAEAYLNCAPGAVADAKALCQNLARMPIDGQIDHSANALADRWE 240 Query: 241 TDEAREGVSAFFERRNPSWRQ 261 T EA+ G+SAFF ++ P WR+ Sbjct: 241 TSEAQAGISAFFSKKTPPWRE 261 Lambda K H 0.321 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory