Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate WP_068006976.1 PsAD2_RS14030 ABC transporter ATP-binding protein
Query= BRENDA::P68187 (371 letters) >NCBI__GCF_001623255.1:WP_068006976.1 Length = 361 Score = 306 bits (783), Expect = 7e-88 Identities = 167/358 (46%), Positives = 230/358 (64%), Gaps = 8/358 (2%) Query: 1 MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL 60 M S+++++++ +GEV V K++NL IH+GEF+V +G SGCGKSTLL +AGL ++ G + Sbjct: 1 MNSIEIKDLSLRFGEVEVLKNLNLSIHKGEFLVLLGSSGCGKSTLLNCVAGLLDLSHGQI 60 Query: 61 FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 120 FI E+ + P +RG+GMVFQSYALYP +SV N+SFGLK AG K I +R+ + AE+ Sbjct: 61 FIDERNVTWEEPKDRGIGMVFQSYALYPQMSVRGNLSFGLKNAGIPKAEIAKRIQRAAEI 120 Query: 121 LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH 180 LQ+ LL RKP ALSGGQRQRVAIGR LV + VFL DEPLSNLDA LR +R+EI+RLH Sbjct: 121 LQIQDLLHRKPAALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRADLRVEINRLH 180 Query: 181 KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN 240 RL TMIYVTHDQ+EAMTLAD+I V+ G + Q+ P ++Y+ P ++++AGFIGSP MN Sbjct: 181 HRLKNTMIYVTHDQIEAMTLADRIAVMRDGNILQLDVPSQIYNRPINKYIAGFIGSPSMN 240 Query: 241 FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIAD--- 297 FL K++A D + Q GA +LG+RPEH+ + A Sbjct: 241 FLEGKLSAG--DNPSFIFGDERFDMSRYRFDGEGQQNGAT-TLGVRPEHIRTGNAAQEMP 297 Query: 298 VILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLF 355 + V+VVE +G++T + + Q R + + V +G +G P + LF Sbjct: 298 ISRNIVVEVVEPMGSDTLVRTHLAG--QEFRLRMDGLASVNKGDNLLVGFDPAQVSLF 353 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 361 Length adjustment: 30 Effective length of query: 341 Effective length of database: 331 Effective search space: 112871 Effective search space used: 112871 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory