Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_068002943.1 PsAD2_RS04510 ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_001623255.1:WP_068002943.1 Length = 363 Score = 289 bits (739), Expect = 9e-83 Identities = 158/361 (43%), Positives = 218/361 (60%), Gaps = 23/361 (6%) Query: 1 MAKIQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTI 60 M +I+ N+ K +G +VL GI+L++ EF V VGPSGCGK+T LR +AGLE+ G I Sbjct: 1 MPRIRLENLVKRYGDFEVLHGINLEMEENEFTVFVGPSGCGKTTTLRMIAGLETVSDGEI 60 Query: 61 SIDGKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISEL 120 I + ++ +EP+ RD+AMVFQ YALYPHM VA+NM F L+L+ EI ++V ++E+ Sbjct: 61 YIGDRPVSQLEPKARDLAMVFQDYALYPHMNVAKNMSFALRLQRRPRKEIDEKVGLVAEM 120 Query: 121 LQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLH 180 L + L RKP ELSGGQRQRVA+GRAL+R LFDEPLSNLDA LR QMR E+ + Sbjct: 121 LGLTKFLHRKPGELSGGQRQRVAMGRALARDAGTFLFDEPLSNLDAKLRCQMRAELAIMR 180 Query: 181 HNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMN 240 + MIYVTHDQ+EA TLGDRI V+ G I+Q GTP E++ +P N F+A F+GSP MN Sbjct: 181 QKVRKNMIYVTHDQIEAMTLGDRIVVMNGGYIQQQGTPEELFKQPANKFVAGFLGSPPMN 240 Query: 241 FLEGAVLE------------KIPWPEAR--------KADQILGIRPDAFALNQGPLGTQE 280 FL + + ++ PE R + ILGIRP L+ P Sbjct: 241 FLGAKIQDLGGQVFVSGDGFEVALPEERASVALGHSASSVILGIRPS--DLHFSPHAPDH 298 Query: 281 VALGDFQIDISENLGGQQMLHGTLAGNNVRILVDSMDNFSMKQTLPLKIDLTKAHLFDKK 340 A+ D ++ +SE +G Q +L + + + S ++ +TL ++ HLFD + Sbjct: 299 EAI-DLKVIVSEYIGAQSVLLCNCGAQKIEVELKSETPIALGETLRFAVNREAIHLFDSE 357 Query: 341 T 341 T Sbjct: 358 T 358 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 363 Length adjustment: 29 Effective length of query: 318 Effective length of database: 334 Effective search space: 106212 Effective search space used: 106212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory