Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_068010540.1 PsAD2_RS21550 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_001623255.1:WP_068010540.1 Length = 370 Score = 281 bits (720), Expect = 2e-80 Identities = 158/335 (47%), Positives = 214/335 (63%), Gaps = 18/335 (5%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 MAT++ + AS S+ K +K +L++ DGEFLVL+G SGCGKST L ++AGLE + DG Sbjct: 1 MATISIEHASKSFGSTK--VLKDISLDVKDGEFLVLLGASGCGKSTLLNIIAGLEPMADG 58 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 I + + V V P++RDIAMVFQ+YALYP+MTV N+ F L++ S+ E V E A Sbjct: 59 TIRLDGEVVNDVHPKNRDIAMVFQSYALYPNMTVERNIAFGLEMRKISKAERKATVREVA 118 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 +TL + L RKP LSGGQRQRVAMGRA+VR P++FL DEPLSNLDAKLR + RT+I Sbjct: 119 STLQIEHLLSRKPSQLSGGQRQRVAMGRALVRRPKIFLFDEPLSNLDAKLRGEMRTEIKK 178 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 L + L T VYVTHDQ EA+T+ DRIA++KDG +QQ+G P+E+Y +PAN++VAGF+G+P Sbjct: 179 LHQTLKATMVYVTHDQIEAMTLADRIAIMKDGEIQQIGTPQEIYSKPANMYVAGFVGAPP 238 Query: 241 MNLGTFS-VKDGDATSGHARIKLSPETLAAMTP---------EDNGRITIGFRPEALEII 290 MN VK + L E + P +N ++ +G RP EII Sbjct: 239 MNFVEVDLVKREEQLGAILPAVLKGEPVDHFLPLPNSKHLEARENTKVILGLRP---EII 295 Query: 291 PEGESTDLSIP---IKLDFVEELGSDSFLYGKLVG 322 + ST S P ++F+E G+D+ +L G Sbjct: 296 TDSTSTHSSAPEIECDVEFLEPTGADTLCIIRLNG 330 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 370 Length adjustment: 30 Effective length of query: 346 Effective length of database: 340 Effective search space: 117640 Effective search space used: 117640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory