Align Mannokinase (EC 2.7.1.7) (characterized)
to candidate WP_068003245.1 PsAD2_RS05040 ROK family protein
Query= reanno::Smeli:SMc03109 (298 letters) >NCBI__GCF_001623255.1:WP_068003245.1 Length = 310 Score = 352 bits (904), Expect = e-102 Identities = 163/296 (55%), Positives = 215/296 (72%) Query: 1 MFIGIDWGGTKMEVIALDRDGETRARHRVPTPTSGYEDCIRAVVELVASAESTAGERGSI 60 M IG+DWGGTK+E++AL +GE R RVPTP + YE C++AV++LV AE+ G+RG++ Sbjct: 1 MRIGLDWGGTKIELLALSNEGEELLRKRVPTPHNDYEGCLKAVLDLVTDAEAETGKRGTV 60 Query: 61 GIGIPGSPNPRTGIVRNSNAVLINGKPLGRDLAAALGREVRLANDANCLAVSEAVDGAGK 120 GIGIPGS +P TG+V+N+N+ +NGK L +DL ALGREVR+ NDANC+AVSEA+DGAG Sbjct: 61 GIGIPGSISPSTGLVKNANSTWMNGKALKQDLTEALGREVRIQNDANCMAVSEAIDGAGA 120 Query: 121 DAGVVFGVIVGTGHGGGLAIGKKVHAGYQGVAAEIGHYPLPWMTKDEYPGHRCWCGKLGC 180 GVV G+I+GTG G G+AI + H G G+ E G+ P+PWM+ E+PG W G G Sbjct: 121 GCGVVHGIIIGTGCGSGIAINGRPHKGANGIGGEWGNIPIPWMSDSEFPGPLNWTGHHGT 180 Query: 181 LDMYACGTGLELDYRMTTGTDRRGRDIIEAKRAGDPVAIGVYGRFVDRLARSLALLTNIV 240 +D+ GTG + DY TTG +GR+IIE RAG+ A+ Y R+V RL R++A+ N++ Sbjct: 181 IDLLCSGTGFQWDYEETTGRLLKGREIIELMRAGEQAALATYQRYVSRLGRAMAMAANLI 240 Query: 241 DPDVFVLGGGMSNVDEIYGELPASITRYLFGDSFETPIRKAVHGDSSGVRGAAWLW 296 DPD FVL GGMSN+DEIY +LP + Y+F D ++ IRKA HGDSSGVRGAAWLW Sbjct: 241 DPDCFVLAGGMSNIDEIYKDLPEVMRPYIFSDGYDFDIRKAKHGDSSGVRGAAWLW 296 Lambda K H 0.319 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 310 Length adjustment: 27 Effective length of query: 271 Effective length of database: 283 Effective search space: 76693 Effective search space used: 76693 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory