Align m-Inositol ABC transporter, permease component (iatP) (characterized)
to candidate WP_068009667.1 PsAD2_RS19325 ribose ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21390 (340 letters) >NCBI__GCF_001623255.1:WP_068009667.1 Length = 314 Score = 221 bits (564), Expect = 1e-62 Identities = 130/307 (42%), Positives = 188/307 (61%), Gaps = 22/307 (7%) Query: 33 IGLVFEMFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVIITTGIDLSSGSVLAL 92 IGL+ M + +FL ++ ++ Q SI ++A+G+T VI+T+GIDLS GS+LA Sbjct: 14 IGLIILMAAVSFANANFL-GVDNMLNILRQTSINAVIAMGMTFVILTSGIDLSVGSILAF 72 Query: 93 SAMIAASLAQTSDFARAVFPSLTDLPVWIPVIAGLGVGLLAGAINGSIIAVTGIPPFIAT 152 + I ASL D P+ + + A + VG GA +G II+ + PFIAT Sbjct: 73 AGAICASLIGM------------DTPLVVALFATIMVGAGLGATSGVIISYFNVQPFIAT 120 Query: 153 LGMMVSARGLARYYTEGQPVSM----LSDSYTAIGHGAM-----PVIIFLVVAVIFHIAL 203 L M RG YT+G+PVS +++S+ G G + PVI+ +V+ I L Sbjct: 121 LVGMTMIRGATLVYTQGRPVSTGSHDVAESFYQFGAGYIFGIPHPVILMIVIFAICWFIL 180 Query: 204 RYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIAGLLAGLAGVVASARAATGQAGMG 263 T++G+Y YAIGGN AR SGINVK+ ++VY+++G LA LAG++ +AR + Q G Sbjct: 181 SQTRFGRYVYAIGGNENVARLSGINVKKVKILVYALSGALAALAGIILTARLESAQPTAG 240 Query: 264 MSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVDAYIQDIIKGLII 323 + YELDAIAA V+GGTSLAGG GR+ GT+IGALI+GV+ + + V +Y Q I KG +I Sbjct: 241 LGYELDAIAAVVLGGTSLAGGKGRVFGTIIGALIIGVLNNALNIMDVSSYYQMIAKGAVI 300 Query: 324 VIAVVID 330 ++AVV+D Sbjct: 301 LLAVVVD 307 Lambda K H 0.326 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 314 Length adjustment: 28 Effective length of query: 312 Effective length of database: 286 Effective search space: 89232 Effective search space used: 89232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory