Align Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate WP_068009665.1 PsAD2_RS19320 ATP-binding cassette domain-containing protein
Query= TCDB::B8H229 (515 letters) >NCBI__GCF_001623255.1:WP_068009665.1 Length = 497 Score = 403 bits (1035), Expect = e-117 Identities = 215/500 (43%), Positives = 318/500 (63%), Gaps = 9/500 (1%) Query: 2 TLLDVSQVSKSFPGVRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVT 61 TLL++ + KSF G+ L VDL + G V AL GENGAGKSTL+KI+S + DAGTV Sbjct: 3 TLLELQGIEKSFSGINVLKSVDLTIRAGRVVALAGENGAGKSTLMKIISGIYQRDAGTVF 62 Query: 62 FAGQVLDPRDAPLRRQQLGIATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADA 121 + G ++ +A GI I+QE NL P+LSVAEN+YLGREP +LG + W ++ ++ Sbjct: 63 YKGHEVEFTNAR-ESMDAGIGIIHQELNLLPDLSVAENIYLGREPTKLGKIQWDVVQRES 121 Query: 122 QALLNDLGLPLNPDAPVRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDRLHA 181 + L L ++P P+ L++A+QQMVEIAKA++LNA +IIMDEPT AL+ E L Sbjct: 122 KKYLAQLKQDIDPTTPLGKLSIAQQQMVEIAKALSLNAEVIIMDEPTDALTDIETAILFE 181 Query: 182 IIAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVGRHV 241 ++ L+A+ ++++SHRLGE+ MCD ++RDG+ V G VAD+ D++R MVGR + Sbjct: 182 VVDELRAQGKGLVFISHRLGEIFQMCDDIAILRDGQMVHQGAVADISEDDLIRHMVGREL 241 Query: 242 EFERRKRRRPPGAVVLKVEGVTPAAPRLSAPGYLRQVSFAARGGEIVGLAGLVGAGRTDL 301 + PG V ++V+ +L+A G +++SF A GE+VG AGLVGAGRT+L Sbjct: 242 SDQYPFVPAEPGDVRIEVD-------KLTARG-AKEISFTANAGEVVGFAGLVGAGRTEL 293 Query: 302 ARLIFGADPIAAGRVLVDDKPLRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRNLSLP 361 A+ IFGA+PI G V +D + + L+SP+D ++A I V EDRKQ+G S+ N+SL Sbjct: 294 AKAIFGANPIRGGSVKIDGQEISLKSPQDGVKAKIGYVTEDRKQEGLVQSQSLGSNMSLT 353 Query: 362 SLKALSALGQWVDERAERDLVETYRQKLRIKMADAETAIGKLSGGNQQKVLLGRAMALTP 421 L V++ +E + Y + IK DA T I LSGGNQQKV + +++ P Sbjct: 354 GLDRFCNTLGIVNKTSEAVTISEYIEAFAIKTRDASTIISNLSGGNQQKVSIAKSLVPEP 413 Query: 422 KVLIVDEPTRGIDIGAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFREGVIV 481 +VLI+DEPTRG+D+GAK E++ +++ L G+ +++ISS++ E++ +SDRI+V +G + Sbjct: 414 EVLILDEPTRGVDVGAKREIYTLINKLKAEGLCILLISSDMPELLGISDRILVLSDGKLT 473 Query: 482 ADLDAQTATEEGLMAYMATG 501 D AT+E +M G Sbjct: 474 GSFDRDEATQENIMRCAVAG 493 Lambda K H 0.320 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 661 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 497 Length adjustment: 34 Effective length of query: 481 Effective length of database: 463 Effective search space: 222703 Effective search space used: 222703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory