Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate WP_068009667.1 PsAD2_RS19325 ribose ABC transporter permease
Query= TCDB::B8H230 (332 letters) >NCBI__GCF_001623255.1:WP_068009667.1 Length = 314 Score = 245 bits (625), Expect = 1e-69 Identities = 138/307 (44%), Positives = 198/307 (64%), Gaps = 9/307 (2%) Query: 22 FARKHRTILFLLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVA 81 F ++++++ L++L+A AN FL N LNIL + SI +IA+GMTFVIL GID++ Sbjct: 6 FISENKSLIGLIILMAAVSFANANFLGVDNMLNILRQTSINAVIAMGMTFVILTSGIDLS 65 Query: 82 VGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVT 141 VGS+LAFA A ++ D P ++AL + ++G G G +++ +V FI T Sbjct: 66 VGSILAFAGAICASLIGM---DTPL--VVALFATIMVGAGLGATSGVIISYFNVQPFIAT 120 Query: 142 LGGMTVWRGATLLLNDGGPIS-GFND---AYRWWGSGEILFLPVPVVIFALVAAAGHVAL 197 L GMT+ RGATL+ G P+S G +D ++ +G+G I +P PV++ ++ A L Sbjct: 121 LVGMTMIRGATLVYTQGRPVSTGSHDVAESFYQFGAGYIFGIPHPVILMIVIFAICWFIL 180 Query: 198 RYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAVAG 257 TR+GR VYA+GGN ARLSG+NV + VYA+ GALA L+G +L+ARL SA+ AG Sbjct: 181 SQTRFGRYVYAIGGNENVARLSGINVKKVKILVYALSGALAALAGIILTARLESAQPTAG 240 Query: 258 TGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLII 317 GYEL IA+VV+GG SL GG G V GT++GAL+IGVL+N L ++ V+SY Q + G +I Sbjct: 241 LGYELDAIAAVVLGGTSLAGGKGRVFGTIIGALIIGVLNNALNIMDVSSYYQMIAKGAVI 300 Query: 318 VAAVAFD 324 + AV D Sbjct: 301 LLAVVVD 307 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 314 Length adjustment: 28 Effective length of query: 304 Effective length of database: 286 Effective search space: 86944 Effective search space used: 86944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory