Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate WP_068004539.1 PsAD2_RS07415 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >NCBI__GCF_001623255.1:WP_068004539.1 Length = 290 Score = 128 bits (322), Expect = 1e-34 Identities = 88/300 (29%), Positives = 163/300 (54%), Gaps = 25/300 (8%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVAL--ITFLAIG 58 ME+ L+ G+ LG+IY L A+G T+V+GI+ + AHG++ +GAF AL +T + Sbjct: 4 MEFVNFYLMPGIVLGSIYALGAVGITLVFGILRFAHLAHGDLATLGAFAALGVVTIFGVS 63 Query: 59 SLGITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYV 118 WV L + ++ A M ++++ Y L P++ ++S++G+++ L+ V Sbjct: 64 P----WVALPVAMVACAFMAIG------IDKLFYDYLSERPKIIVVMSSLGIALMLRAVV 113 Query: 119 QILQGARSKP-----LQPILPGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSL 173 Q++ G ++ ++P + + D + Y +A +I + +++ F Q +T Sbjct: 114 QVVWGVDTETYTRGIVRPDDYWGIRIRDREI---YTIIAMFLI-VGVLWAFLQ---KTKW 166 Query: 174 GRAQRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGV 233 G+A RA + +A L GV+ ++ LT+ + L A +G L I + +G+ + Sbjct: 167 GKAMRAMSDNPDLALLSGVDNRKITMLTWGIVGVLCAASGFF-LGINTELKPLMGWTMLL 225 Query: 234 KAFTAAVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLL 293 F AA+LGG+G + GA++GG+++G+ E ++ E+K F IL+L+L+ RPTGLL Sbjct: 226 PMFAAAILGGVGRVEGAVIGGLIVGIAEETSVLFIPGEYKAAMAFAILLLILLVRPTGLL 285 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 290 Length adjustment: 26 Effective length of query: 275 Effective length of database: 264 Effective search space: 72600 Effective search space used: 72600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory