Align ABC transporter permease (characterized, see rationale)
to candidate WP_068000560.1 PsAD2_RS00560 ABC transporter permease
Query= uniprot:A0A166R405 (325 letters) >NCBI__GCF_001623255.1:WP_068000560.1 Length = 332 Score = 270 bits (691), Expect = 3e-77 Identities = 154/331 (46%), Positives = 216/331 (65%), Gaps = 9/331 (2%) Query: 1 MNTASLAGKRSGNFYGLGTYLGLAG---ALLAMVALFSVLSSHFLSYDTFSTLANQIPDL 57 + T + SGNF + T L AG ALLA++ FS+ + HFL+ + + + Q+ Sbjct: 3 IQTGDEVAQASGNF-SIRTVLHNAGIGLALLALILFFSIFTEHFLTANNITNILTQVTIN 61 Query: 58 MVLAVGMTFVLIIGGIDLSVGSVLA----LAASAVSVAILGWGWSVLPAALLGMAVAALA 113 ++LAVGMTFV++IGGIDLSVGSV+A +A A+++A LG +++ A + AV + Sbjct: 62 LILAVGMTFVILIGGIDLSVGSVMAFASVIAGKAITLAGLGPFEAIVLAVIAATAVGVVC 121 Query: 114 GTITGSITVAWRIPSFIVSLGVLEMARGLAYQMTGSRTAYIGD-AFAWLSNPIAFGISPS 172 G I G+IT W +PSFI++LG+L +ARG A Q + ++T Y AF + + +G+ Sbjct: 122 GAINGTITARWSLPSFIITLGMLNIARGAALQASNAQTIYSFPLAFEDFGSAMFYGVPVV 181 Query: 173 FIIALLIIFIAQAVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGIAA 232 F++AL ++FIA +L TVFGR L GIG NEEAVRLAG + YKI F++ GL AGIAA Sbjct: 182 FMVALALVFIAWFILNFTVFGRLLYGIGNNEEAVRLAGHSVYRYKIAAFTICGLTAGIAA 241 Query: 233 LFQISRLEAADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQI 292 + ++RL + P AG G EL IAAV+IGGTSL GGRGSVI T G II VLA GL I Sbjct: 242 VVYMARLNISSPIAGIGFELNAIAAVIIGGTSLNGGRGSVIGTLIGAFIIGVLANGLILI 301 Query: 293 GATEPTKRIITGAVIVVAVVLDTYRSQRASR 323 G ++ +++ITG VI++AV+LD YR++ R Sbjct: 302 GLSDFMRQMITGVVIIIAVILDYYRAKYTRR 332 Lambda K H 0.325 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 332 Length adjustment: 28 Effective length of query: 297 Effective length of database: 304 Effective search space: 90288 Effective search space used: 90288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory