Align Ribose import permease protein RbsC (characterized)
to candidate WP_068009667.1 PsAD2_RS19325 ribose ABC transporter permease
Query= SwissProt::P0AGI1 (321 letters) >NCBI__GCF_001623255.1:WP_068009667.1 Length = 314 Score = 364 bits (934), Expect = e-105 Identities = 183/304 (60%), Positives = 237/304 (77%) Query: 16 WLMEQKSLIALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMAVGMTLVILTSGIDLS 75 ++ E KSLI L++L+A VS + NF ++N+ NIL+QTS+NA++A+GMT VILTSGIDLS Sbjct: 6 FISENKSLIGLIILMAAVSFANANFLGVDNMLNILRQTSINAVIAMGMTFVILTSGIDLS 65 Query: 76 VGSLLALTGAVAASIVGIEVNALVAVAAALALGAAIGAVTGVIVAKGRVQAFIATLVMML 135 VGS+LA GA+ AS++G++ +VA+ A + +GA +GA +GVI++ VQ FIATLV M Sbjct: 66 VGSILAFAGAICASLIGMDTPLVVALFATIMVGAGLGATSGVIISYFNVQPFIATLVGMT 125 Query: 136 LLRGVTMVYTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRL 195 ++RG T+VYT G PV+TG + A+ F FG G G+P PV +M ++F W++L TR Sbjct: 126 MIRGATLVYTQGRPVSTGSHDVAESFYQFGAGYIFGIPHPVILMIVIFAICWFILSQTRF 185 Query: 196 GRYIYALGGNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVARLSSAQPTAGTGYEL 255 GRY+YA+GGNE RLSGINV K+KI+VY+L G LA+LAGII ARL SAQPTAG GYEL Sbjct: 186 GRYVYAIGGNENVARLSGINVKKVKILVYALSGALAALAGIILTARLESAQPTAGLGYEL 245 Query: 256 DAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVL 315 DAIAAVVLGGTSLAGGKGR+ GT+IGALI+G LNN LN++ VSSYYQMI K VILLAV+ Sbjct: 246 DAIAAVVLGGTSLAGGKGRVFGTIIGALIIGVLNNALNIMDVSSYYQMIAKGAVILLAVV 305 Query: 316 VDNK 319 VD++ Sbjct: 306 VDSR 309 Lambda K H 0.324 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 314 Length adjustment: 27 Effective length of query: 294 Effective length of database: 287 Effective search space: 84378 Effective search space used: 84378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory