Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate WP_068002937.1 PsAD2_RS04500 sugar ABC transporter permease
Query= reanno::Phaeo:GFF1304 (288 letters) >NCBI__GCF_001623255.1:WP_068002937.1 Length = 307 Score = 137 bits (345), Expect = 3e-37 Identities = 85/281 (30%), Positives = 149/281 (53%), Gaps = 6/281 (2%) Query: 1 MATQHSRSAARIMMAPAVILLLGWMLVPLTMTLYFSFKKYLPL-RGGDLGWVGFDNYARF 59 +A + +R + + PA I+++ +L P+ +Y SF + P R G ++G NY Sbjct: 3 LAIKANRLTPYMFLLPAGIVMILALLYPIGYMIYASFLDWSPSQRIGQAEFIGIRNYINL 62 Query: 60 LSSSAFWPSVQATLVIVGGVLAITVILGVFLALLLNQPMWGQGIVRILVIAPFFVMPTVS 119 L +AF S T+ V+ + +I+GV LA+LL++ + G ++R + I P + P V Sbjct: 63 LGDAAFRESFWVTIRFAAIVVTLEMIVGVGLAMLLDRNIRGMVLLRTVFILPMMIAPIVV 122 Query: 120 ALVWKNMFMDPVNGLFAHLWKAFGAEPVSWLSEASLQSIILIVS--WQWLPFATLILLTA 177 L+W+ MF P G+F + K+FG E + WL++++ I ++++ WQW PF ++ L A Sbjct: 123 GLMWRYMF-HPTVGIFNRMLKSFGFEGIPWLADSTWAFIAIVIADVWQWTPFIFILALAA 181 Query: 178 IQSLDSEQLEAAEMDGAPPVARFGYITLPHLSRAITVVVLIQTIFLLSIFAEIFVTTQGS 237 QSL LEAAE+DGA + I LP + + V ++++ I + + I V T G Sbjct: 182 TQSLPRSALEAAEIDGANEWQKIVMIKLPLMMPVLIVTLMLRLIDVFKVLEVILVLTNGG 241 Query: 238 FG--TKTLTYLIYQRVLESQNVGLGSAGGVYAIILANIVAI 276 G T+ L I++ E Q +G +A +++ ++ I Sbjct: 242 PGLSTEILALRIFRTAQEFQELGEAAAMSNMLLMMLMVLTI 282 Lambda K H 0.328 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 307 Length adjustment: 26 Effective length of query: 262 Effective length of database: 281 Effective search space: 73622 Effective search space used: 73622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory