Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized, see rationale)
to candidate WP_068004173.1 PsAD2_RS05440 TRAP transporter small permease
Query= uniprot:Q9KQS0 (232 letters) >NCBI__GCF_001623255.1:WP_068004173.1 Length = 210 Score = 126 bits (317), Expect = 3e-34 Identities = 79/212 (37%), Positives = 113/212 (53%), Gaps = 15/212 (7%) Query: 19 SRVGQFTDSIEEFLIAFFMGAMTLLTFANVIMRYLFNDNILWALEGTVFMFAWMVLVGAS 78 SR+ + D+ EE IA + MTL+TF V+MRY FN AL+ T +FAW++L G S Sbjct: 2 SRLNKIIDAFEEGFIATILAVMTLVTFWQVVMRYGFNSGWGGALQFTRVLFAWLILFGMS 61 Query: 79 FGVKRHFHIGVDVLINIAPARLRKLYALVAVACCLAFSILLLIGSWNYWHPFITER---- 134 +G+K H+GVD I + P + + + L+ L ++ LL W W + R Sbjct: 62 YGLKIGSHLGVDAFIRLFPKPVFRTFGLIGALVTLLYAALLFDADWFGWVLGLDNRGSSG 121 Query: 135 ------AWYETDDIPMPDMLQFLADWVNE--GERYEKLPRFIPYAALPIGMALLTFRFLQ 186 + Y I M D+ +W E G + E++PR+ Y LPIG+ LL FR LQ Sbjct: 122 GAFDYVSRYYKLPIGMEDLK--FPEWYQEMFGVK-ERVPRWWGYVILPIGLGLLAFRSLQ 178 Query: 187 IAWQIITGKLDRMIAGHEAEEDLEALKAELSE 218 + W I+TG+ D MIA HEAEE +E K L + Sbjct: 179 MCWLILTGQRDTMIAAHEAEELVEENKDVLKD 210 Lambda K H 0.329 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 210 Length adjustment: 22 Effective length of query: 210 Effective length of database: 188 Effective search space: 39480 Effective search space used: 39480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory