Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_068010615.1 PsAD2_RS21780 ROK family protein
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_001623255.1:WP_068010615.1 Length = 311 Score = 180 bits (457), Expect = 3e-50 Identities = 104/294 (35%), Positives = 156/294 (53%), Gaps = 3/294 (1%) Query: 4 GIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGT-VGM 62 GIDLGGTK E A +A + R+ TP++ Y ++ + ++ E+ +G + +G+ Sbjct: 6 GIDLGGTKIEATAFDEAWAVVESKRIATPKETYEGLVDALCEMIHWLEEVSGNKDLPIGV 65 Query: 63 GIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGA 122 GIPG S TG AN +G+ D+ ++L R V ND NC A+SEAV GA Sbjct: 66 GIPGFYSKRTGKFLTANLP-ASGRTLHDDIISKLGRAVTFENDCNCFALSEAVLGAGRSY 124 Query: 123 QTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQG 182 TVF +I+GTG G G NG G NG AGE+GH +P+ +L E + C CG+ G Sbjct: 125 DTVFGLILGTGVGGGCCSNGHTVSGLNGAAGEYGHLGIPYAAMTKLGL-EPLKCGCGRTG 183 Query: 183 CIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVNI 242 C ET+++G G + ++G A+ I + D + +R + A+ +A + Sbjct: 184 CFETYLAGPGISRLANHVTGKAVDAQTITKAAAAGDVPMQEVMRLWSQLAAELVAALQCS 243 Query: 243 LDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAA 296 LDPD IVLGGG+S + + +T+ Q + + + A+ GDSSG RGAA Sbjct: 244 LDPDCIVLGGGLSKIPNIERTIAQALPGKLLNHTEPPMICVAQFGDSSGTRGAA 297 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 311 Length adjustment: 27 Effective length of query: 275 Effective length of database: 284 Effective search space: 78100 Effective search space used: 78100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory