Align ABC transporter (characterized, see rationale)
to candidate WP_068006976.1 PsAD2_RS14030 ABC transporter ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_001623255.1:WP_068006976.1 Length = 361 Score = 293 bits (751), Expect = 4e-84 Identities = 164/358 (45%), Positives = 230/358 (64%), Gaps = 11/358 (3%) Query: 1 MIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL 60 M +++ +++ + G + +L++++L I GEF+V +G SGCGKSTLL +AGL + G + Sbjct: 1 MNSIEIKDLSLRFGEVEVLKNLNLSIHKGEFLVLLGSSGCGKSTLLNCVAGLLDLSHGQI 60 Query: 61 LIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQI 120 ID R V EP++RG+GMVFQSYALYP MSV N+SFGLK A K + +R+ + A+I Sbjct: 61 FIDERNVTWEEPKDRGIGMVFQSYALYPQMSVRGNLSFGLKNAGIPKAEIAKRIQRAAEI 120 Query: 121 LQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLH 180 LQ+ LL RKP LSGGQRQRVA+GRA+ R+ D+ LFDEPLSNLDA LR +R EI RLH Sbjct: 121 LQIQDLLHRKPAALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRADLRVEINRLH 180 Query: 181 DRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMN 240 RL +TMIYVTHDQ+EAMTLAD+I V+ G + Q+ P ++Y RP ++++AGF+GSP MN Sbjct: 181 HRLKNTMIYVTHDQIEAMTLADRIAVMRDGNILQLDVPSQIYNRPINKYIAGFIGSPSMN 240 Query: 241 FLSARLQTPGETSLV-DTLVWGITSLPFDSSNLAAGTPLSLGIRPEHV----SLKAADGT 295 FL +L S + + ++ FD G +LG+RPEH+ + + + Sbjct: 241 FLEGKLSAGDNPSFIFGDERFDMSRYRFDGEGQQNGA-TTLGVRPEHIRTGNAAQEMPIS 299 Query: 296 AGVVVTAVEYLGSETYV--HLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFD 351 +VV VE +GS+T V HL GQ+ L R + A GD + + D + LF+ Sbjct: 300 RNIVVEVVEPMGSDTLVRTHL-AGQEFRL--RMDGLASVNKGDNLLVGFDPAQVSLFE 354 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 361 Length adjustment: 30 Effective length of query: 351 Effective length of database: 331 Effective search space: 116181 Effective search space used: 116181 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory