Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_068006982.1 PsAD2_RS14045 carbohydrate ABC transporter substrate-binding protein
Query= uniprot:A0A165KPY4 (416 letters) >NCBI__GCF_001623255.1:WP_068006982.1 Length = 413 Score = 221 bits (562), Expect = 4e-62 Identities = 134/411 (32%), Positives = 210/411 (51%), Gaps = 12/411 (2%) Query: 4 MTKIAAVAVGLAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKGHTWRDFAVAGGG 63 + + A LA+ A ++EV H+WTSGGEA +V + GHTW D A+AGG Sbjct: 4 LNALLVTAALLASTTFTQAADLEVTHWWTSGGEAAAVRVFADAVNNSGHTWVDSAIAGG- 62 Query: 64 GDSAMTVLKSRVISGNPPSAAQTK-GPAIQEWASEGVLANMDTLAKAEKWDELL-PKVVA 121 D+A V+ SR+ G+P A Q G ++ G++ ++ +A+ E W +++ P + Sbjct: 63 -DNARPVIISRISGGDPMQATQLNTGRDAEDLIRAGLMTDLTEVAEKEGWADIIRPAKLL 121 Query: 122 DVMKYKGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVPVA 181 D +Y+G PVN+H WMW + + ++ G+A +P W EF +A L+ G+ P+A Sbjct: 122 DSCRYEGRIYCVPVNIHSFQWMWLNRKVYEQNGLA-VPTNWSEFVQSAPTLRDKGITPLA 180 Query: 182 HGGQNWQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDPGA 241 GG+ WQ + VGG Y+ + A + M+K + F + D G Sbjct: 181 VGGEPWQLSGMSGVFQVAVGGVDLYRKIKAQKSVEAASGPEMRKVFQAFADARDLGDNGH 240 Query: 242 PGRDWNLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVDSF 301 GR WN AT+M+I GKA Q+MGDWA+GEF A + GKD+ C G DSF Sbjct: 241 VGRAWNNATSMVITGKAAAQIMGDWAQGEFSMAEQVAGKDYDCLPGLGMNPVLDTGGDSF 300 Query: 302 ILFKL--KDAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKD 359 K KAQ ++AS ++S A Q FNL KGS+PVR ++ + C K K Sbjct: 301 FFPKPVGDQPDVVKAQLEMASLLVSKAVQVDFNLKKGSLPVRGDVDLNAANSCMK---KG 357 Query: 360 FVDTAKSGGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKKIA 410 + ++P A + + T+G ++D+ +F+N +++V +A + A Sbjct: 358 IAILSDPENILP--ATEQSFSSDTQGQLEDLWVEFFNAPEMTVDEAQARYA 406 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 413 Length adjustment: 31 Effective length of query: 385 Effective length of database: 382 Effective search space: 147070 Effective search space used: 147070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory