Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_068005085.1 PsAD2_RS09075 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_001623255.1:WP_068005085.1 Length = 363 Score = 290 bits (742), Expect = 4e-83 Identities = 159/328 (48%), Positives = 214/328 (65%), Gaps = 11/328 (3%) Query: 2 AGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIE 61 A +++ + K +G T A+ +NL + G F V +GPSGCGKST LR +AGLE +SG+I Sbjct: 8 AHLELSNLTKSWGDTTAVNQVNLSVTGGSFTVLLGPSGCGKSTTLRLIAGLEEATSGQIS 67 Query: 62 IGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVL 121 IGGRDVT PA RD++MVFQ+YAL+PH++V EN+ FG+KV R R+ AA +L Sbjct: 68 IGGRDVTHRSPAQRDISMVFQNYALFPHISVAENILFGLKVRKVGRAERDGRLKHAADLL 127 Query: 122 QLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHK 181 + L+RKP QLSGGQ+QRVA+GRAIV V L DEPLSNLDAKLR +MRVEL L + Sbjct: 128 GISHLLERKPSQLSGGQQQRVALGRAIVSQKPVCLMDEPLSNLDAKLRQEMRVELRALQQ 187 Query: 182 QLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMNV 241 QLG TM+YVTHDQ EA+TMAD++V++N G++EQ SP ++Y +P S F A FIG+P MN+ Sbjct: 188 QLGLTMVYVTHDQTEAITMADQVVLMNNGQVEQAASPKEIYERPASVFTARFIGTPPMNI 247 Query: 242 FSSD-------VGLQDISLDAS-AAFVGCRPEHIEIVPDGDGHIAATVHVKERLGGESLL 293 S D + +Q + S + +G RPE I + G+ I V E +G ++L Sbjct: 248 VSLDAIRSVTPLTVQHLLPKTSVGSRLGLRPEDIRLT--GENGIPGQVLSLEYMGADTLA 305 Query: 294 YLGLKGGGQIVARVGGDDETKVGAAVSL 321 + GG +++ RV G E K G V L Sbjct: 306 NCSV-GGEKMLVRVKGTTELKPGQTVGL 332 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 363 Length adjustment: 29 Effective length of query: 309 Effective length of database: 334 Effective search space: 103206 Effective search space used: 103206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory