Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_068009665.1 PsAD2_RS19320 ATP-binding cassette domain-containing protein
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_001623255.1:WP_068009665.1 Length = 497 Score = 362 bits (929), Expect = e-104 Identities = 202/490 (41%), Positives = 305/490 (62%), Gaps = 4/490 (0%) Query: 6 LLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILL 65 LL+ + + K+++G+ L+ L++RAG V AL G NGAGKST + I+ GI QRDAG++ Sbjct: 4 LLELQGIEKSFSGINVLKSVDLTIRAGRVVALAGENGAGKSTLMKIISGIYQRDAGTVFY 63 Query: 66 NGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRRTR 125 G V+F E++ AGI +I QEL +P ++VAENI+LGREP + G I + + R ++ Sbjct: 64 KGHEVEFTNARESMDAGIGIIHQELNLLPDLSVAENIYLGREPTKLGKIQWD-VVQRESK 122 Query: 126 ELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFKA 185 + L L+ D+D T+P+ +LS+AQ Q+VEIAKA S + +V+IMDEPT A+ + E LF+ Sbjct: 123 KYLAQLKQDIDPTTPLGKLSIAQQQMVEIAKALSLNAEVIIMDEPTDALTDIETAILFEV 182 Query: 186 IRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQELT 245 + L AQG G+V++SHRL E+ Q+ DD +I RDG V G +ADI D L+R +VG+EL+ Sbjct: 183 VDELRAQGKGLVFISHRLGEIFQMCDDIAILRDGQMVHQGAVADISEDDLIRHMVGRELS 242 Query: 246 RIDHKVGRECAANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIYGL 305 V E + ++VD L+ G +IS GE++G GL+G+GR+E I+G Sbjct: 243 DQYPFVPAE-PGDVRIEVDKLTARGA-KEISFTANAGEVVGFAGLVGAGRTELAKAIFGA 300 Query: 306 TVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNIALSAYKRL-S 364 GSV + G+ + + P+ + A + VTEDRK GLV + S+ SN++L+ R + Sbjct: 301 NPIRGGSVKIDGQEISLKSPQDGVKAKIGYVTEDRKQEGLVQSQSLGSNMSLTGLDRFCN 360 Query: 365 SWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLCDE 424 + ++N E + ++ IKT ++++SGGNQQKV +AK L EP L+ DE Sbjct: 361 TLGIVNKTSEAVTISEYIEAFAIKTRDASTIISNLSGGNQQKVSIAKSLVPEPEVLILDE 420 Query: 425 PTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTISTDTA 484 PTRG+D GAK+EIY L+++ G +++SS+ PELL +SDRI V G+L Sbjct: 421 PTRGVDVGAKREIYTLINKLKAEGLCILLISSDMPELLGISDRILVLSDGKLTGSFDRDE 480 Query: 485 LSQEALLRLA 494 +QE ++R A Sbjct: 481 ATQENIMRCA 490 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 28 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 497 Length adjustment: 34 Effective length of query: 461 Effective length of database: 463 Effective search space: 213443 Effective search space used: 213443 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory