Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_067644904.1 I596_RS04715 enoyl-CoA hydratase
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_001632775.1:WP_067644904.1 Length = 270 Score = 159 bits (402), Expect = 6e-44 Identities = 90/246 (36%), Positives = 134/246 (54%), Gaps = 1/246 (0%) Query: 8 LEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGAD 67 +E +G AVVT++ P A N D+L + ++ + D ++ A+++ G GEK F AGAD Sbjct: 19 IEIDGHAAVVTLSNPPA-NTWTRDSLAALRDLVRALHADRDIYAMVIVGEGEKFFSAGAD 77 Query: 68 ISEMKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSN 127 + + + + R+ + F L IAA+NG+A+GGG E A++CD+RIA Sbjct: 78 LKQFADGDKARAREAARRFGEAFETLSAFRGVSIAAINGYAMGGGLECALACDLRIAEEQ 137 Query: 128 ARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSE 187 A+ PE +G+ P GGTQ L RLVG G AK++I + I A ALRIGLV +VV + Sbjct: 138 AQLALPEATVGLLPCAGGTQNLPRLVGEGWAKRMILLGERIDAATALRIGLVEEVVPKGQ 197 Query: 188 LMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMT 247 + A E + +P +V K + TAL E EAF + F + DQ + + Sbjct: 198 ALARALEWGRQAGKQSPTSVAACKALVQATRSQPHATALVHEREAFVDLFDSADQVEGVA 257 Query: 248 AFIEKR 253 AF+EKR Sbjct: 258 AFLEKR 263 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 270 Length adjustment: 25 Effective length of query: 236 Effective length of database: 245 Effective search space: 57820 Effective search space used: 57820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory