Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_067643684.1 I596_RS02455 3-hydroxybutyrate dehydrogenase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_001632775.1:WP_067643684.1 Length = 260 Score = 100 bits (248), Expect = 4e-26 Identities = 70/210 (33%), Positives = 106/210 (50%), Gaps = 15/210 (7%) Query: 7 SVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKL---GNNCVFAPA 63 S+ G VA ITG ASGLG AE GA+ + DL G +A A +L G + Sbjct: 2 SLSGKVAYITGAASGLGKRIAEVYAANGAAVAIADLNLEGAQAAAAELAATGAKAIGVKV 61 Query: 64 DVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLM 123 DVTSE +V+ ++A FG+VD+ V+ AGI + +K Q T E+++R++ ++L Sbjct: 62 DVTSEAEVEASVAETIKAFGKVDILVSNAGIQI------VKPVQDFTYEEWRRMIAIHLD 115 Query: 124 GTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIA 183 G F R +M GQ G II S + +A Y A+K ++G+ +A Sbjct: 116 GAFLTTRACLKDMYAR-----GQGGAIIYMGSAHSKTASKLKAPYVAAKHALLGLARTVA 170 Query: 184 RDLAPIGIRVMTIAPGLFGTPLL-TSLPEK 212 ++ P +R I PG TPL+ +PE+ Sbjct: 171 KEGGPAKVRANVICPGFVRTPLVEKQIPEQ 200 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 260 Length adjustment: 25 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory