Align crotonase (EC 4.2.1.150) (characterized)
to candidate WP_067646635.1 I596_RS08905 enoyl-CoA hydratase
Query= metacyc::MONOMER-13469 (259 letters) >NCBI__GCF_001632775.1:WP_067646635.1 Length = 264 Score = 121 bits (304), Expect = 1e-32 Identities = 86/260 (33%), Positives = 133/260 (51%), Gaps = 7/260 (2%) Query: 6 IILEKDGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGKAFVAGA 65 I +++ G+ A + L+RP NA +AA + E+ AA+ + D V AV++TG+G F AGA Sbjct: 5 IQIDRRGSAAYLVLDRPGVHNAFDAALIAELTAALKSLDADPAVRAVVVTGAGATFSAGA 64 Query: 66 DIAEMKDLTA---VEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRI 122 D+ M+ + A E R S+ ++ R L L KP IA +NG A GGG L CDI + Sbjct: 65 DLNWMRSMAAADEAENRADSLRLAQLMRTLNFLSKPTIARVNGSAYGGGVGLVACCDIAV 124 Query: 123 ASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVV 182 AKF E LG+ P + ++ AIGV A+ + +V +A EA RIGL+++ V Sbjct: 125 GVESAKFSLSEAKLGLVPAV-ISPYVSAAIGVRQARRYFASAEVFDAAEAARIGLLHECV 183 Query: 183 EPDKLLEEAKALVDAIIVNAPIAVRMCK--AAINQGLQCD-IDTGVAYEAEVFGECFATE 239 + L + L+ + PIA K A G+ D + A + + Sbjct: 184 AAEALDATVERLLHMLGKCGPIAQDEAKRLALRVAGITRDGAEQADRENAALIARLRVSA 243 Query: 240 DRVEGMTAFVEKRDKAFKNK 259 + EG+TAF++KR A+ + Sbjct: 244 EGQEGLTAFLDKRAPAWAGR 263 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 264 Length adjustment: 25 Effective length of query: 234 Effective length of database: 239 Effective search space: 55926 Effective search space used: 55926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory