Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_067644904.1 I596_RS04715 enoyl-CoA hydratase
Query= BRENDA::P76082 (255 letters) >NCBI__GCF_001632775.1:WP_067644904.1 Length = 270 Score = 154 bits (388), Expect = 2e-42 Identities = 96/245 (39%), Positives = 136/245 (55%), Gaps = 8/245 (3%) Query: 14 LLTLNRPAARNALNNAL--LMQLVNELEAAATDTSISVCVITGNA-RFFAAGADLNEMAE 70 ++TL+ P A ++L L LV L A D I VI G +FF+AGADL + A+ Sbjct: 27 VVTLSNPPANTWTRDSLAALRDLVRALHA---DRDIYAMVIVGEGEKFFSAGADLKQFAD 83 Query: 71 KDLAATLNDTRP--QLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLP 128 D A R + + L AF IAA+NGYA+G G E AL CD+ +A E A+ LP Sbjct: 84 GDKARAREAARRFGEAFETLSAFRGVSIAAINGYAMGGGLECALACDLRIAEEQAQLALP 143 Query: 129 EITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYAL 188 E T+G++P AGGTQ L R VG+ A +M+L GE I A A + GLV +V P L AL Sbjct: 144 EATVGLLPCAGGTQNLPRLVGEGWAKRMILLGERIDAATALRIGLVEEVVPKGQALARAL 203 Query: 189 QLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKR 248 + + + SP ++ A K ++ ++ L ER+ F L + D+ EG++AFL+KR Sbjct: 204 EWGRQAGKQSPTSVAACKALVQATRSQPHATALVHEREAFVDLFDSADQVEGVAAFLEKR 263 Query: 249 TPDFK 253 P +K Sbjct: 264 APQWK 268 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 270 Length adjustment: 25 Effective length of query: 230 Effective length of database: 245 Effective search space: 56350 Effective search space used: 56350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory