Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_067648668.1 I596_RS12940 enoyl-CoA hydratase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_001632775.1:WP_067648668.1 Length = 260 Score = 190 bits (483), Expect = 2e-53 Identities = 113/263 (42%), Positives = 157/263 (59%), Gaps = 8/263 (3%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EK 59 MA+ N+L RG V +T+NRP LNAL+ + EL A + D+A+ +V+ G+ EK Sbjct: 1 MAFRNLLSTDRGGVRTITINRPDKLNALDRQTIGELQIAFEQARHDEAVRVVVLAGAGEK 60 Query: 60 AFAAGADIGMMSTYTYMDVYK----GDYITRNWETVRSIRKPIIAAVAGFALGGGCELAM 115 AF AGADI ++T T + G + R ET + KP+IA + GFALGGG ELAM Sbjct: 61 AFVAGADITELATLTPVQAQAFARAGQRMVRAIET---LGKPVIARLNGFALGGGLELAM 117 Query: 116 MCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAEAERAG 175 C + A+ AK GQPEI LG++PG GGTQRL R +A A++LCL +DAA A + G Sbjct: 118 ACHLRIASTRAKVGQPEINLGVIPGFGGTQRLARLAGRAAALELCLLGTPIDAARAYQLG 177 Query: 176 LVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVNRAYETTLAEGVHFERRLFHSLF 235 LV+RV+ +L + A A +A A+ V ++V A E + EG+ +E + F F Sbjct: 178 LVNRVVEPEALDEAVQAVADQLAASAPQALAGVLDTVLAATELAIEEGLDYEAKAFSLCF 237 Query: 236 ATEDQKEGMAAFVEKRKPVFKHR 258 +TED +EG AAF+ +RK VF R Sbjct: 238 STEDMREGTAAFLARRKAVFSGR 260 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory