Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_067650170.1 I596_RS15900 3-oxoacyl-ACP reductase FabG
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_001632775.1:WP_067650170.1 Length = 243 Score = 140 bits (352), Expect = 3e-38 Identities = 90/253 (35%), Positives = 132/253 (52%), Gaps = 12/253 (4%) Query: 3 LKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGR 62 + DK ++VTG SRGIG+AIA+ A +G D+ ++ R V A+I ALGR Sbjct: 1 MTDKTILVTGSSRGIGKAIALRLARDGYDLVLH-------CRSRLDEATAVAADIAALGR 53 Query: 63 RVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNL 122 V ++ +V R + VEA G + NAGI +AF MPPE ++ V NL Sbjct: 54 GVRVLQFDVGDRAAAAAALLADVEAHGCPYGVVCNAGIARDNAFPAMPPEDWDAVVHTNL 113 Query: 123 NGAFYVTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALG 182 +G + V + + G IV +S+S ++G Q +Y+ KAG+ ++ AV L Sbjct: 114 DGFYNVLHPLTMPLVRRRKPGRIVTLASVSGIIGNRGQVNYSAAKAGIIGATKALAVELA 173 Query: 183 PYGIRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDRAR 242 I N V PG I T++ + DEA KA IP GR+G+P +VA V+FL + A Sbjct: 174 SRAITVNCVAPGLIDTEMVDARVLDEALKA-----IPAGRVGKPAEVAALVSFLMGEDAA 228 Query: 243 YVTGAALLVDGGL 255 Y+T + V+GGL Sbjct: 229 YITRQVISVNGGL 241 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 243 Length adjustment: 24 Effective length of query: 236 Effective length of database: 219 Effective search space: 51684 Effective search space used: 51684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory