Align Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale)
to candidate WP_068331569.1 A3K86_RS12910 PTS glucose transporter subunit IIA
Query= uniprot:Q9KZP2 (149 letters) >NCBI__GCF_001650345.1:WP_068331569.1 Length = 169 Score = 85.1 bits (209), Expect = 5e-22 Identities = 46/120 (38%), Positives = 68/120 (56%), Gaps = 4/120 (3%) Query: 4 VSSPLAGRAIGLAAVPDPVFSGAMVGPGTAIDPVREPSEAVAPVDGVIVSLHP--HAFVV 61 + +PL+G + + VPD VF+ +VG G AI P ++ VAPV G I + HAF + Sbjct: 23 IIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAG--NKMVAPVSGTIGKIFETNHAFSI 80 Query: 62 VDESGHGVLTHLGIDTVQLNGEGFELLVNKGDTVVRGQGVVRWDPAAVEAAGKSPICPIV 121 + G + H GIDTV+L GEGF + +G TV G ++ +D A +E KS + P+V Sbjct: 81 ESDDGIELFVHFGIDTVELKGEGFTRIAEEGQTVKVGDTIIEFDLALLEEKAKSTLTPVV 140 Lambda K H 0.316 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 81 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 149 Length of database: 169 Length adjustment: 17 Effective length of query: 132 Effective length of database: 152 Effective search space: 20064 Effective search space used: 20064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory