Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_068336297.1 A3K86_RS21200 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_001650345.1:WP_068336297.1 Length = 245 Score = 311 bits (798), Expect = 6e-90 Identities = 156/241 (64%), Positives = 188/241 (78%), Gaps = 2/241 (0%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 I Q++KWYG FH L+ I+LT+ RGER+VI GPSGSGKST+IRCIN LE + +G I V Sbjct: 7 IAFQQVDKWYGNFHALKSIDLTIQRGERLVICGPSGSGKSTLIRCINGLENYDTGAIEVA 66 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYL 142 G L D +++ +R +VGMVFQHFNLFPHLT+LENLTLAP V K+ +A+ A+ YL Sbjct: 67 GKRL--DKQHLQTIRGKVGMVFQHFNLFPHLTVLENLTLAPKRVLKLSDTDAKALALEYL 124 Query: 143 EKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQ 202 E+V I QA KYP QLSGGQQQRVAIARSLCMKP I+LFDEPTSALDPEMI+EVLD M + Sbjct: 125 ERVHIAHQADKYPAQLSGGQQQRVAIARSLCMKPDILLFDEPTSALDPEMIREVLDVMKE 184 Query: 203 LAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQILG 262 LA EG+TM+CVTHEMGFA+ VA+RV+FM +G+IVE P F NPQ RT+QFL QIL Sbjct: 185 LANEGITMVCVTHEMGFARQVADRVVFMDEGEIVEVAPPAQLFDNPQHSRTQQFLEQILS 244 Query: 263 H 263 + Sbjct: 245 Y 245 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory