Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_068331027.1 A3K86_RS11410 phosphoglucosamine mutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_001650345.1:WP_068331027.1 Length = 445 Score = 222 bits (565), Expect = 2e-62 Identities = 159/451 (35%), Positives = 230/451 (50%), Gaps = 33/451 (7%) Query: 3 KLFGTFGVRGIANE-KITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEAL 61 K FGT GVRG+ E ITPEF +K+G A G +L ++G KK V++G+DTR+SG ML+ AL Sbjct: 5 KYFGTDGVRGLVGEGPITPEFVLKLGWAAGRVLSKQGTKK--VLIGKDTRISGYMLESAL 62 Query: 62 ISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLK 121 +GL + G G PTPAV + T+ F A+ G VI+ASHNP NGIK G L Sbjct: 63 EAGLAAAGLQAAFTGPMPTPAVAYLTRTFRAEAGIVISASHNPYYDNGIKFFSAQGTKLP 122 Query: 122 KEREAIVEELFFK-----EDFDRAKWYEIGEVRREDIIKPYIEAIK----SKVDVEAIKK 172 E E +E K E + K Y I +D YIE K +K D+ K Sbjct: 123 DEIELAIEAELDKPLTCVESAELGKAYRI-----DDAAGRYIEFCKGTFPTKYDLSDYK- 176 Query: 173 RKPFVVVDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVK 232 +VVD ++GA P + +ELG +VIT+ +P+G N E +++ V Sbjct: 177 ----IVVDCAHGATYHIAPAVFKELGAEVITLGCEPNG--TNINHEVGATDIRALQAKVV 230 Query: 233 ALGADFGVAQDGDADRAVFIDENGRFIQGDKTFALVA-DAVLKEKGGGLLVTTVATSNLL 291 A FG+A DGD DR + +DE G I GD+ ++A DA+ + + G +V T+ T+ + Sbjct: 231 KEKAHFGIALDGDGDRVIMVDEEGNKIDGDQIAYIIARDALRRGELKGGVVGTLMTNMGM 290 Query: 292 DDIAKKHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVE 351 + K G +R KVGD V L ++ IG E +G VI + V DG + +V+ Sbjct: 291 EVALKNLGIPFVRAKVGDRYVMEELQNHDWLIGAENSGHVILLDKVTTGDGIVAGLQVMA 350 Query: 352 IFAKSGKKFSELIDELPKYYQIKTKRHVEGDRHAIVNKVAEMARERGYTVDTTDGAKIIF 411 S EL D + + Q+ +GD + + + A + V+ G Sbjct: 351 SMVGSKMSLKELADGMTMFPQVLENVRFKGDSNPLESDAVIAATQ---AVEAKLG----- 402 Query: 412 EDGWVLVRASGTEPIIRIFSEAKSKEKAQEY 442 + G VL+R SGTEP+IR+ E ++ E QEY Sbjct: 403 DTGRVLLRKSGTEPLIRVMVEGENAELVQEY 433 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 445 Length adjustment: 33 Effective length of query: 422 Effective length of database: 412 Effective search space: 173864 Effective search space used: 173864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory