Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_068331602.1 A3K86_RS13005 transporter substrate-binding domain-containing protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_001650345.1:WP_068331602.1 Length = 257 Score = 240 bits (613), Expect = 2e-68 Identities = 122/259 (47%), Positives = 172/259 (66%), Gaps = 3/259 (1%) Query: 1 MKKLVLLGALALSVLSLPTFADE-KPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCE 59 MKK +L A+ ++ + A E K ++ GIE AYPPF+ P+G + GFD D+ NALC+ Sbjct: 1 MKKWILAAAVVSALGATSVQAKEWKQIRFGIEGAYPPFSWTEPNGELKGFDVDMANALCK 60 Query: 60 EMKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAG 119 E+K KC V Q++DG+IP+L RK DAI+++MSIT++RKK VDFT KY P + V K G Sbjct: 61 ELKAKCKIVAQDWDGIIPSLLARKYDAIIAAMSITEERKKKVDFTGKYALIPNKFVAKKG 120 Query: 120 TQVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTV 179 TQ+ A L G KIGVQR + H+++ + K EI YGS ++ YLD+ AGR+ + Sbjct: 121 TQIDFTEAGLDGVKIGVQRATTHDKYLTDNFK--SVEIVRYGSFDDAYLDLKAGRIASVL 178 Query: 180 ADATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDKINAAIVAIRA 239 DA+ L++G L G G+ F+GP+ TD K+FGDG GIAVRK DK K++ AI+++R Sbjct: 179 GDASALEEGLLNKTGGDGYEFIGPSLTDPKWFGDGFGIAVRKQDKDLTKKLDEAILSLRE 238 Query: 240 NGKYKQIQDKYFNFDIYGK 258 G Y++I KYF +D+YGK Sbjct: 239 KGIYQEIAAKYFAYDVYGK 257 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory