Align Phosphotransferase system IIB component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate WP_068336976.1 A3K86_RS18055 PTS transporter subunit EIIA
Query= TCDB::Q5V5X1 (143 letters) >NCBI__GCF_001650345.1:WP_068336976.1 Length = 622 Score = 74.3 bits (181), Expect = 3e-18 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 1/92 (1%) Query: 3 LVAVTSCPTGIAHSQMAAENLEQTAEEQGHDIKVEVQGAMGAENELSDSDIEAADAAIIA 62 ++AVTSCP+G+AH+ +AA++LE+ A G IKVE QGA G N +++ DI A I A Sbjct: 527 ILAVTSCPSGVAHTFLAAKSLEKAACALGVKIKVETQGANGIINRITERDIAKAKLVIFA 586 Query: 63 SDTSV-SQDRFSGVPLIDGTVKDAVNDAEGMI 93 D ++ + +RF+ + ID + KDA+ +A +I Sbjct: 587 HDVAIKAPERFTNIATIDVSTKDAMLNAAALI 618 Lambda K H 0.308 0.124 0.328 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 143 Length of database: 622 Length adjustment: 26 Effective length of query: 117 Effective length of database: 596 Effective search space: 69732 Effective search space used: 69732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory