Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_068333494.1 A3K86_RS16310 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::Q0K1X1 (214 letters) >NCBI__GCF_001650345.1:WP_068333494.1 Length = 218 Score = 159 bits (402), Expect = 4e-44 Identities = 82/199 (41%), Positives = 116/199 (58%) Query: 4 QTSPLLQRLADVPVIPVLEFHSVDEALHVSEALVTGGLPLLEITLRTPVALEAIKAVAAA 63 +T+ + L D+ V+PV++ + ++A+ +++ LV GLP EIT RT A +AI + AA Sbjct: 2 KTNTWIDALRDLRVMPVIQIENANDAVPLAKVLVENGLPAAEITFRTQAAAQAIANIRAA 61 Query: 64 LPQACVGAGTVLNVEQLHAVRDAGAQFAVSPGLTPALAEGAQGAGISLLPGVATASEAMA 123 P+ + AGTVL EQ A AGA F VSPG P + I ++PGV S+ Sbjct: 62 YPEITLCAGTVLTPEQADAAIAAGADFVVSPGFNPTTVKYCLDNDIKIIPGVNNPSQVEQ 121 Query: 124 ALEAGFTFLKFFPAQAAGGVPMLKSLGGPLPQLRFCPTGGIDAALAPTYLALPNVVCVGG 183 ALE G +KFFPA+A+GG+ MLKSL GP ++ PTGG+ YLA+ V GG Sbjct: 122 ALEMGVQAMKFFPAEASGGISMLKSLTGPYGNIQLMPTGGVKPTNLMDYLAISQVFACGG 181 Query: 184 SWVVPKDAVASGDWGRIRT 202 +W+ P A+A+ DW I T Sbjct: 182 TWIAPTAAIAANDWQSIAT 200 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 214 Length of database: 218 Length adjustment: 22 Effective length of query: 192 Effective length of database: 196 Effective search space: 37632 Effective search space used: 37632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory