Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate WP_068331602.1 A3K86_RS13005 transporter substrate-binding domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >NCBI__GCF_001650345.1:WP_068331602.1 Length = 257 Score = 113 bits (283), Expect = 3e-30 Identities = 77/250 (30%), Positives = 127/250 (50%), Gaps = 16/250 (6%) Query: 8 LLASLAAAAFCTTGAQAQD-NVLRVGTDATFPPMEFVE-NGKRTGFDIELVEAIAKTMGK 65 +LA+ +A T QA++ +R G + +PP + E NG+ GFD+++ A+ K + Sbjct: 5 ILAAAVVSALGATSVQAKEWKQIRFGIEGAYPPFSWTEPNGELKGFDVDMANALCKELKA 64 Query: 66 QVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGGLVVMVKADNKAI 125 + + V D+ G+IP L+++++D ++A+ IT+ERKK VDFT Y + K + Sbjct: 65 KCKIVAQDWDGIIPSLLARKYDAIIAAMSITEERKKKVDFTGKYALIPNKFVAKKGTQID 124 Query: 126 NKLADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEMFNLVDIGRADAAVTGKPAA 185 A LDG K+ VQ T YLT+ F V+ V + + + GR A+V G +A Sbjct: 125 FTEAGLDGVKIGVQRATTHDKYLTDNFKSVEIVRYGSFDDAYLDLKAGRI-ASVLGDASA 183 Query: 186 FQ-----------YVRTRPGLRVLDEQLTTEEYGMALRKDTPELTKAVNGAITKLKADGT 234 + Y P L D + + +G+A+RK +LTK ++ AI L+ G Sbjct: 184 LEEGLLNKTGGDGYEFIGPSL--TDPKWFGDGFGIAVRKQDKDLTKKLDEAILSLREKGI 241 Query: 235 YAAIVKKWFS 244 Y I K+F+ Sbjct: 242 YQEIAAKYFA 251 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 257 Length adjustment: 24 Effective length of query: 225 Effective length of database: 233 Effective search space: 52425 Effective search space used: 52425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory